| Primary information |
|---|
| SALID | SAL_10136 |
| Biomarker name | Leptin |
| Biomarker Type | NA |
| Sampling Method | Twenty four patients with SLE (all women) and 5 controls. |
| Collection Method | An average 2 ml of unstimulated whole saliva was collected. |
| Analysis Method | two stochastic sensors based on metal nanocomposites-graphene pastes |
| Collection Site | Whole Saliva |
| Disease Category | Autoimmune Disorder |
| Disease/Condition | Systemic lupus erythematosus |
| Disease Subtype | NA |
| Fold Change/ Concentration | NA |
| Up/Downregulated | NA |
| Exosomal | NA |
| Organism | Homo sapiens |
| PMID | 29621567 |
| Year of Publication | 2018 |
| Biomarker ID | P41159 |
| Biomarker Category | Protein |
| Sequence | MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Title of study | Salivary biomarkers of inflammation in systemic lupus erythematosus |
| Abstract of study | Saliva is currently used as a reliable diagnostic fluid in a wide range of local and systemic diseases. However, the link between salivary diagnosis and the inflammatory process in autoimmune diseases has not yet been explored. The aim of our study is to assess possible correlations between salivary inflammatory markers and systemic lupus erythematosus (SLE). Patients fulfilling the Systemic Lupus International Collaborating Clinics (SLICC) diagnosis criteria were included. Salivary and serum levels of interleukin-6 (IL-6), leptin, monocyte chemoattractant protein-1 (MCP-1) and plasminogen activator inhibitor-1 (PAI-1) were determined using stochastic sensors. Serum leptin and IL-6 had significantly higher levels in SLE patients compared to non-SLE. Also, salivary IL-6 levels highly correlated with the serum IL-6 levels. A positive correlation was found between salivary and serum levels of IL-6, signaling salivary IL-6 as a reliable marker for assessing the inflammation process in SLE. |