Primary information |
---|
SALID | SAL_10083 |
Biomarker name | Biotin--[biotin carboxyl-carrier protein] ligase |
Biomarker Type | NA |
Sampling Method | 337 patients with breast benign cyst or tumor (BB) or breast cancer (I/II stage) and 110 healthy humans were probed. |
Collection Method | Whole saliva (about 1 mL) was collected and placed on ice. |
Analysis Method | Lectin blotting |
Collection Site | Whole Saliva |
Disease Category | Cancer |
Disease/Condition | Breast Cancer |
Disease Subtype | NA |
Fold Change/ Concentration | NA |
Up/Downregulated | NA |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 29402727 |
Year of Publication | 2018 |
Biomarker ID | G0AE97 |
Biomarker Category | Protein |
Sequence | MPYGLAMSLFFIVFTWVKPCVASCIFLAFSPLFPVTPATMRGMTAQFIAPISPASQLSAARIAAFAGHHAEQCLIEVVAETGSTNADLLARVSGNGRDSGKDALRAPTLLVALTQTAGRGRAGRAWLTAPAAALTFSLAWPFASPLQALVGLPLAVGVTIAETLADFGVEVQLKWPNDVLQGGRKLAGILIETATAPDQQLWAVIGIGINLSIPEKLQEQIGRRTANLPAAAAQDRDLLLGSLLSGLAQNMWQFESEGLSAFVERWNRLHAFAGQQVAILDQGKTLHEGKALGIDQIGRLLLQTDGGSNPIAIMAGDISLRPKEG |
Title of study | Salivary Glycopatterns as Potential Biomarkers for Screening of Early-Stage Breast Cancer |
Abstract of study | OBJECTIVE: We systematically investigated and assessed the alterations of salivary glycopatterns and possibility as biomarkers for diagnosis of early-stage breast cancer.DESIGN: Alterations of salivary glycopatterns were probed using lectin microarrays and blotting analysis from 337 patients with breast benign cyst or tumor (BB) or breast cancer (I/II stage) and 110 healthy humans. Their diagnostic models were constructed by a logistic stepwise regression in the retrospective cohort. Then, the performance of the diagnostic models were assessed by ROC analysis in the validation cohort. Finally, a double-blind cohort was tested to confirm the application potential of the diagnostic models.RESULTS: The diagnostic models were constructed based on 9 candidate lectins (e.g., PHA-E+L, BS-I, and NPA) that exhibited significant alterations of salivary glycopatterns, which achieved better diagnostic powers with an AUC value >0.750 (p<0.001) for the diagnosis of BB (AUC: 0.752, sensitivity: 0.600, and specificity: 0.835) and I stage breast cancer (AUC: 0.755, sensitivity: 0.733, and specificity: 0.742) in the validation cohort. The diagnostic model of I stage breast cancer exhibited a high accuracy of 0.902 in double-blind cohort.CONCLUSIONS: This study could contribute to the screening for patients with early-stage breast cancer based on precise alterations of salivary glycopatterns. |