Primary information |
---|
SALID | SAL_10067 |
Biomarker name | Small integral membrane protein 18 |
Biomarker Type | NA |
Sampling Method | Saliva samples were collected from forty OC patients and forty age matched healthy control subjects. |
Collection Method | Saliva was collected, immediately after sample collection, protease inhibitor was added and stored at -80degreeC till further use. |
Analysis Method | Western blotting and ELISA |
Collection Site | Saliva |
Disease Category | Cancer |
Disease/Condition | Ovarian Cancer |
Disease Subtype | NA |
Fold Change/ Concentration | 2.4 |
Up/Downregulated | Upregulated |
Exosomal | NA |
Organism | Homo sapiens |
PMID | 29222021 |
Year of Publication | 2017 |
Biomarker ID | P0DKX4 |
Biomarker Category | Protein |
Sequence | MASSHWNETTTSVYQYLGFQVQKIYPFHDNWNTACFVILLLFIFTVVSLVVLAFLYEVLDCCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV |
Title of study | Identification and validation of salivary proteomic signatures for non-invasive detection of ovarian cancer |
Abstract of study | Ovarian cancer (OC) is one of the most lethal cancers among all gynecological malignancies. An effective and non-invasive screening approach is needed urgently to reduce high mortality rate. The purpose of this study was to identify the salivary protein signatures (SPS) for non-invasive detection of ovarian cancer. Differentially expressed SPS were identified by fluorescence-based 2D-DIGE coupled with MALDI/TOF-MS. The expression levels of three differential proteins (Lipocalin-2, indoleamine-2, 3-dioxygenase1 (IDO1) and S100A8) were validated using western blotting and ELISA. Immunohistochemistry and qRT-PCR were performed in an independent cohort of ovarian tumor tissues. 25 over expressed and 19 under expressed (p<0.05) proteins between healthy controls and cancer patients were identified. Lipocalin-2, IDO1 and S100A8 were selected for initial verification and successfully verified by immunoassay. Diagnostic potential of the candidate biomarkers was evaluated by ROC analysis. The selected biomarkers were further validated by immunohistochemistry in an independent cohort of ovarian tissues. The global expression of selected targets was also analyzed by microarray and validated using qRT-PCR to strengthen our hypothesis. Tumor secreted proteins identified by 'dual-omics' strategy, whose concentration are significantly high in ovarian cancer patients have obvious potential to be used as screening biomarker after large scale validation. |