Peplife 2.0 - Year of Publication

Browsing Year-wise: 1996 - 2000

Browse Results:

Filter by Length
Minimum Length
Maximum Length

ID	PMID	YEAR	Sequence	Name	Length	N-ter MOD	C-ter MOD	Linear/Cyclic	Chirality	Chem-MOD	Origin	Nature	Incubation Time	Concentration	Half Life	Protease	Assay	Test Sample	Vivo/Vitro	Reference	Patent No.	Activity
1049	10495424	1999	AAGIGILTV	MART-127 €“35	9	Free	Free	Linear	L	None	Synthetic	Immunogenic peptides	Not given	1 µM	22	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	IC50 for inhibition of binding of a standard peptide to HLA-A*0201 molecules is 0.5 µM
1050	10495424	1999	AAGIGILTV	PEG-MART-1	9	Free	Pegylation	Linear	L	None	Synthetic	Immunogenic peptides	Not given	Not given	Stability increased	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	IC50 for inhibition of binding of a standard peptide to HLA-A*0201 molecules is >35 µM
1051	10495424	1999	aAGIGILTv	D-MART-1	9	Free	Free	Linear	Mix	None	Synthetic	Immunogenic peptides	Not given	Not given	Stability increased	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	Not tested
1052	10495424	1999	AAGIGILTV	Glyco-MART-1	9	Asn(Î²-D-GlcNHAc)	Free	Linear	L	None	Synthetic	Immunogenic peptides	Not given	Not given	Stability increased	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	Not tested
1053	10495424	1999	AAGIGILTV	Cap-MART-1	9	Acetylation	Amidation	Linear	L	None	Synthetic	Immunogenic peptides	Not given	Not given	Stability increased	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	IC50 for inhibition of binding of a standard peptide to HLA-A*0201 molecules is 65 µM
1054	10495424	1999	AAGIGILTV	N-MART-1	9	Acetylation	Free	Linear	L	None	Synthetic	Immunogenic peptides	Not given	Not given	Stability increased	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	IC50 for inhibition of binding of a standard peptide to HLA-A*0201 molecules is 35 µM
1055	10495424	1999	AAGIGILTV	C-MART-1	9	Free	Amidation	Linear	L	None	Synthetic	Immunogenic peptides	Not given	Not given	Stability increased	Human plasma proteases and proteases of VMM5 cytotoxic T-lymphocyte	Not mentioned	VMM5 cytotoxic T-lymphocyte line incubated in human plasma	in vitro	None	None	IC50 for inhibition of binding of a standard peptide to HLA-A*0201 molecules is 7 µM
1082	11099487	2000	RQIKIWFQNRRMKWKKNELKRAFAALRDQI	Int-H1-S6A,F8A	30	Free	Free	Linear	L	None	C-Myc derivative	Antiproliferative and proapoptotic	Not reported	Not mentioned	11.95	Fetal calf serum proteases	HPLC	Fetal bovine serum batch1	in vitro	None	None	Not reported
1083	11099487	2000	RQIKIWFQNRRMKWKKNELKRAFAALRDQI	Int-H1-S6A,F8A	30	Free	Free	Linear	L	None	C-Myc derivative	Antiproliferative and proapoptotic	Not reported	Not mentioned	18.73	Fetal calf serum proteases	HPLC	Fetal bovine serum batch2	in vitro	None	None	Not reported
1084	11099487	2000	RQIKIWFQNRRMKWKKNELKRAFAALRDQI	Int-H1-S6A,F8A	30	Free	Free	Linear	L	None	C-Myc derivative	Antiproliferative and proapoptotic	Not reported	Not mentioned	4.62	Fetal calf serum proteases	HPLC	Fetal bovine serum batch3	in vitro	None	None	Not reported
1085	11099487	2000	RQIKIWFQNRRMKWKKNELKRAFAALRDQI	Int-H1-S6A,F8A	30	Free	Free	Linear	L	None	C-Myc derivative	Antiproliferative and proapoptotic	Not reported	Not mentioned	7.29	Fetal calf serum proteases	HPLC	Fetal bovine serum batch4	in vitro	None	None	Not reported
1113	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=3 µg/ml for M. Luteus ATCC 9341
1114	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=4 µg/ml for M. Luteus ATCC 9341
1115	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=7 µg/ml for M. Luteus ATCC 9341
1116	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=3 µg/ml for M. Luteus ATCC 9341
1117	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for M. Luteus ATCC 9342
1118	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=3 µg/ml for M. Luteus ATCC 9343
1119	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=3.12 µg/ml for M. Luteus ATCC 9344
1120	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=6 µg/ml for M. Luteus ATCC 9345
1121	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=6.25 µg/ml for S. Aureus ATCC 6538
1122	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=9 µg/ml for S. Aureus ATCC 6538
1123	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=19 µg/ml for S. Aureus ATCC 6539
1124	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=10 µg/ml for S. Aureus ATCC 6540
1125	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=25 µg/ml for S. Aureus ATCC 6541
1126	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=10 µg/ml for S. Aureus ATCC 6542
1127	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=9 µg/ml for S. Aureus ATCC 6543
1128	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=11 µg/ml for S. Aureus ATCC 6544
1129	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=1.56 µg/ml for S. Epidemidis ATCC 12228
1130	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=1.56 µg/ml for S. Epidemidis ATCC 12229
1131	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=3.12 µg/ml for S. Epidemidis ATCC 12228
1132	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=1.56 µg/ml for S. Epidemidis ATCC 12229
1133	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=3.12 µg/ml for S. Epidemidis ATCC 12228
1134	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=1.56 µg/ml for S. Epidemidis ATCC 12229
1135	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=2 µg/ml for S. Epidemidis ATCC 12228
1136	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	Not reported
1137	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=25 µg/ml for MRSA SR 1550
1138	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=50 µg/ml for MRSA SR 1551
1139	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=100 µg/ml for MRSA SR 1552
1140	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=50 µg/ml for MRSA SR 1553
1141	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=>100 µg/ml for MRSA SR 1554
1142	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=42 µg/ml for MRSA SR 1555
1143	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=38 µg/ml for MRSA SR 1556
1144	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=16 µg/ml for MRSA SR 1557
1145	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for M. smegmatis ATCC 607
1146	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=25 µg/ml for M. smegmatis ATCC 607
1147	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=>100 µg/ml for M. smegmatis ATCC 607
1148	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=25 µg/ml for M. smegmatis ATCC 607
1149	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=25 µg/ml for M. smegmatis ATCC 607
1150	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for M. smegmatis ATCC 612
1151	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for M. smegmatis ATCC 613
1152	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	Not reported
1153	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=10 µg/ml for E. coli ATCC 2592
1154	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for E. coli ATCC 2592
1155	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=23 µg/ml for E. coli ATCC 2592
1156	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for E. coli ATCC 2592
1157	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=31 µg/ml for E. coli ATCC 2592
1158	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=21 µg/ml for E. coli ATCC 2592
1159	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=19 µg/ml for E. coli ATCC 2592
1160	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=11 µg/ml for E. coli ATCC 2592
1161	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=4 µg/ml for P. aeruginosa ATCC 9027
1162	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for P. aeruginosa ATCC 9027
1163	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=20 µg/ml for P. aeruginosa ATCC 9027
1164	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=6.25 µg/ml for P. aeruginosa ATCC 9027
1165	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=25 µg/ml for P. aeruginosa ATCC 9027
1166	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=10 µg/ml for P. aeruginosa ATCC 9027
1167	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=6.25 µg/ml for P. aeruginosa ATCC 9027
1168	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=5 µg/ml for P. aeruginosa ATCC 9027
1169	10461747	1998	KKVVFKVKFK	KSL	10	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	6	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for C. albicans ATCC 36232
1170	10461747	1998	KÎ¨[CH2NH]KVVFKVKFK	KSL1	10	Free	Free	Linear	L	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	14	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=9 µg/ml for C. albicans ATCC 36232
1171	10461747	1998	KÎ¨[CH2NH]KVVFKVKFk	KSL2	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=17 µg/ml for C. albicans ATCC 36232
1172	10461747	1998	KKÎ¨[CH2NH]VVFKVKFk	KSL3	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=6.25 µg/ml for C. albicans ATCC 36232
1173	10461747	1998	KÎ¨[CH2NH]KÎ¨[CH2NH]VVFKVKFk	KSL4	10	Free	Free	Linear	Mix	Reduced amide bonds Î¨(CH2NH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	>81	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=31 µg/ml for C. albicans ATCC 36232
1174	10461747	1998	KÎ¨[CH2OCONH]KVVFKVKFk	KSL5	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	23	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=10 µg/ml for C. albicans ATCC 36232
1175	10461747	1998	KÎ¨[CH2OCONH]KÎ¨[CH2OCONH]VVFKVKFk	KSL6	10	Free	Free	Linear	Mix	Reduced carbamate Î¨(CH2OCONH)	Synthetic	Antimicrobial	Not reported	100 µg/mL	67	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=11 µg/ml for C. albicans ATCC 36232
1176	10461747	1998	kKVVFKVKFk	KSL7	10	Free	Free	Linear	Mix	None	Synthetic	Antimicrobial	Not reported	100 µg/mL	22	Mouse serum proteases	RP-HPLC	Mouse serum	in vitro	None	None	MIC=12.5 µg/ml for C. albicans ATCC 36232
1181	10773009	2000	TaLIDNNATEEILY	TX14(A)	14	Free	Free	Linear	Mix	None	Synthetic derivative of prosaposin	Neurotrophic factor	9 minutes	Not mentioned	4.2 ±0.3	Rat serum proteases	Radioactivity measured with a gamma counter	Injected in jugular vein of male Sprague-Dawley rats	in vivo	None	None	ED50=1.00 ±0.11ng/ml
1182	10773009	2000	TaIIDNNKTEKEISY	TX15-2	15	Free	Free	Linear	Mix	None	Synthetic derivative of prosaposin	Neurotrophic factor	9 minutes	Not mentioned	2.5 ±0.3	Rat serum proteases	Radioactivity measured by a gamma counter	Injected in jugular vein of male Sprague-Dawley rats	in vivo	None	None	ED50=1.00 ±0.09ng/ml
1183	10541299	1999	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR	Epoetin	166	Free	Free	Cyclic	L	Three N-linked carbohydrate chains	Recombinant human erythropoietin	Stimulates erythropoiesis	Not mentioned	Not mentioned	8.5 ±2.4	Human blood proteases	ELISA	Subcutaneously injected into patients with end-stage renal failure	in vivo	http://www.drugbank.ca/drugs/DB00016	None	Not reported
1184	10541299	1999	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR	Novel erythropoiesis stimulating protein (NESP)	166	Free	Free	Cyclic	L	Five N-linked carbohydrate chains	Hyperglycosylated analogue of recombinant human erythropoietin	Stimulates erythropoiesis	Not mentioned	Not mentioned	25.3 ±2.2	Human blood proteases	ELISA	Subcutaneously injected into patients with end-stage renal failure	in vivo	http://www.drugbank.ca/drugs/DB00017	None	Not reported
1185	11054637	2000	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH	Human brain natriuretic peptide (hBNP)	32	Free	Free	Linear	L	None	Cardiac origin	Regulation of extracellular fluid and blood pressure homeostasis	Not mentioned	Not mentioned	12.7	Sheep blood proteases	HPLC	Infused in pulmonary artery of sheep	in vivo	2136732	None	Kd=8pM for receptor binding
1186	11054637	2000	MMRDSGCFGRRLDRIGSLSGLGCNVLRRY	Ovine Brain natriuretic peptide (oBNP)	29	Free	Free	Linear	L	None	Cardiac origin	Regulation of extracellular fluid and blood pressure homeostasis	Not mentioned	Not mentioned	2.6	Sheep blood proteases	HPLC	Infused in pulmonary artery of sheep	in vivo	None	None	Kd=16pM for receptor binding
1187	11054637	2000	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	Atrial natriuretic peptide (ANP)	28	Free	Free	Linear	L	None	Cardiac origin	Regulation of extracellular fluid and blood pressure homeostasis	Not mentioned	Not mentioned	3	Sheep blood proteases	HPLC	Infused in pulmonary artery of sheep	in vivo	1826098	None	Kd=10pM for receptor binding
1188	11054637	2000	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH	Human brain natriuretic peptide (hBNP)	32	Free	Free	Linear	L	None	Cardiac origin	Regulation of extracellular fluid and blood pressure homeostasis	Not mentioned	Not mentioned	3.1	Human blood proteases	HPLC	Injected in humans	in vivo	2136732	None	Kd=8pM for receptor binding
1189	11054637	2000	MMRDSGCFGRRLDRIGSLSGLGCNVLRRY	Ovine Brain natriuretic peptide (oBNP)	29	Free	Free	Linear	L	None	Cardiac origin	Regulation of extracellular fluid and blood pressure homeostasis	Not mentioned	Not mentioned	3.1	Human blood proteases	HPLC	Injected in humans	in vivo	None	None	Kd=16pM for receptor binding
1190	11054637	2000	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	Atrial natriuretic peptide (ANP)	28	Free	Free	Linear	L	None	Cardiac origin	Regulation of extracellular fluid and blood pressure homeostasis	Not mentioned	Not mentioned	22	Human blood proteases	HPLC	Injected in humans	in vivo	1826098	None	Kd=10pM for receptor binding
1191	10670753	1999	SPTLAYAVP	Human thyrotropin-releasing hormone (TRH)-associated peptide 3 (hTAP-3)	9	Free	Free	Linear	L	None	Product of proteolysis of preproTRH	Serum hTAP-3 concentration was increased in patients with hyperthyroidism	15 min	Not mentioned	3.5	Human serum proteases	Radioimmunoassay	Human serum	in vivo	None	None	Not reported
1670	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	Not mentioned	10 ±1	Angiotensin-converting enzyme	Radioimmunoassay and HPLC	Blood sample of normotensive Sprague-Dawley rat	in vivo	None	None	Not mentioned
1671	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	10 ±1	Angiotensin-converting enzyme	Radioimmunoassay and HPLC	Blood sample of anesthetized spontaneously hypertensive rat	in vivo	None	None	Not mentioned
1672	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	9 ±1	Angiotensin-converting enzyme	Radioimmunoassay and HPLC	Blood sample of mRen-2 transgenic rat	in vivo	None	None	Not mentioned
1673	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~11 ±1	Angiotensin-converting enzyme and losartan(AT1 antagonist)	Radioimmunoassay and HPLC	Blood sample of normotensive Sprague-Dawley rat	in vivo	None	None	Not mentioned
1674	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~11 ±1	Angiotensin-converting enzyme and losartan(AT1 antagonist)	Radioimmunoassay and HPLC	Blood sample of anesthetized spontaneously hypertensive rat	in vivo	None	None	Not mentioned
1675	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~14 ±1	Angiotensin-converting enzyme and losartan(AT1 antagonist)	Radioimmunoassay and HPLC	Blood sample of mRen-2 transgenic rat	in vivo	None	None	Not mentioned
1676	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~60 ±1	Angiotensin-converting enzyme and lisinopril(inhibitor)	Radioimmunoassay and HPLC	Blood sample of normotensive Sprague-Dawley rat	in vivo	None	None	Not mentioned
1677	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~44 ±1	Angiotensin-converting enzyme and lisinopril(inhibitor)	Radioimmunoassay and HPLC	Blood sample of anesthetized spontaneously hypertensive rat	in vivo	None	None	Not mentioned
1678	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~29 ±1	Angiotensin-converting enzyme and lisinopril(inhibitor)	Radioimmunoassay and HPLC	Blood sample of mRen-2 transgenic rat	in vivo	None	None	Not mentioned
1679	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~45 ±1	Angiotensin-converting enzyme,losartan(AT1 antagonist)and lisinopril(inhibitor)	Radioimmunoassay and HPLC	Blood sample of normotensive Sprague-Dawley rat	in vivo	None	None	Not mentioned
1680	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~49 ±1	Angiotensin-converting enzyme,losartan(AT1 antagonist)and lisinopril(inhibitor)	Radioimmunoassay and HPLC	Blood sample of anesthetized spontaneously hypertensive rat	in vivo	None	None	Not mentioned
1681	9740616	1998	DRVYIHP	Ang-(1-7)	7	Free	Free	Linear	L	None	Angiotensinogen	Antihypertensive	30 min	10 µg	~40 ±1	Angiotensin-converting enzyme,losartan(AT1 antagonist)and lisinopril(inhibitor)	Radioimmunoassay and HPLC	Blood sample of mRen-2 transgenic rat	in vivo	None	None	Not mentioned
1682	9806949	1998	NDWF-Dpr-L	MEN 11420	6	Glycosylation	Free	Cyclic	L	Dpr-2,3-Diaminopropionic acid	MEN 10627	Tachykinin NK2 receptor antagonist	Not reported	Not mentioned	44 ±3	Not mentioned	HPLC	Rat blood plasma	in vivo	None	None	Not mentioned
1683	9822665	1998	MLPGLALLLLAAWTARALEVPYPYDVPDYASNKGAIIGLMVGGVVIATVIVITLVVMLKKKQYEQKLISEEDL	H26-57C	74	Free	Free	Linear	L	None	Amyloid precursor protein	Not mentioned	40 minutes	Not mentioned	8	Î³-secretase	Pulse chase experiment	Human embryonic kidney cells	in vitro	None	None	Not mentioned
1684	9822665	1998	MLPGLALLLLAAWTARALEVPYPYDVPDYASNKGAIIGLMVGGVVIATVIVITLVVMLKKKQYEQKLISEEDL	H26-57C	74	Free	Free	Linear	L	None	Amyloid precursor protein	Not mentioned	40 minutes	Not mentioned	1	Î³-secretase (protease) Lactacystin(protease inhibitor)	Pulse chase experiment	Human embryonic kidney cells	in vitro	None	None	Not mentioned
1685	9822665	1998	MLPGLALLLLAAWTARALEVPYPYDVPDYASNKGAIIGLMVGGVVIATVIVITLVVMLKKKQYEQKLISEEDL	H26-57C	74	Free	Free	Linear	L	None	Amyloid precursor protein	Not mentioned	40 minutes	Not mentioned	10	Î³-secretase (protease) ALLN(protease inhibitor)	Pulse chase experiment	Human embryonic kidney cells	in vitro	None	None	Not mentioned
1702	10611139	1999	H(2me)wAWfK	Hexarelin	6	Free	Amidation	Linear	Mix	2me-2-methyl(tryptophan)	Analog of GHRP-6	Peptidyl growth hormone causing GH releasing effect.	Not reported	10 to 25 iu of oxytocin	75.9 ±9.3	Blood proteases	LC-MS/MS	Intravenous injection,Blood sample from male Sprague-Dawley rats	in vivo	None	None	Not mentioned
1703	10611139	1999	H(2me)wAWfK	Hexarelin	6	Free	Amidation	Linear	Mix	2me-2-methyl(tryptophan)	Analog of GHRP-6	Peptidyl growth hormone causing GH releasing effect.	Not reported	5 µg/kg	71.9 ±11.2	Blood proteases	LC-MS/MS	Intravenous injection,Blood sample from male Sprague-Dawley rats	in vivo	None	None	Not mentioned
1704	10611139	1999	H(2me)wAWfK	Hexarelin	6	Free	Amidation	Linear	Mix	2me-2-methyl(tryptophan)	Analog of GHRP-6	Peptidyl growth hormone causing GH releasing effect.	Not reported	10 µg/kg	61.4 ±9.5	Blood proteases	LC-MS/MS	Intravenous injection,Blood sample from male Sprague-Dawley rats	in vivo	None	None	Not mentioned
1705	10611139	1999	H(2me)wAWfK	Hexarelin	6	Free	Amidation	Linear	Mix	2me-2-methyl(tryptophan)	Analog of GHRP-6	Peptidyl growth hormone causing GH releasing effect.	Not reported	50 µg/kg	57.0 ±9.1	Blood proteases	LC-MS/MS	Intravenous injection,Blood sample from male Sprague-Dawley rats	in vivo	None	None	Not mentioned
1706	10647619	2000	GPRPP-Aba-GGaG	TP 850	10	Free	Free	Linear	Mix	4-aminobutyric acid (Aba)	Modified fibrin Î± chain N-terminal peptide	Blood Coagulation	Not reported	11 to 25 iu of oxytocin	4	Blood proteases	Radiolabelling and HPLC	Intravenous injection,Blood sample of rabbit	in vivo	None	None	Platelet aggregation inhibition, IC50=236Î¼m for dog and IC50=167Î¼m for rabbit.
1707	10871321	2000	RPPGF	BK1-5	5	Free	Free	Linear	L	None	Metabolite of bradykinin	Not mentioned	Not reported	106 cpm/200Î¼l/mouse	~90	Aminopeptidase P,Dipeptidyl-peptidaseIV,KininaseII,KininaseI and neutral endopeptidase	HPLC-ESI-MS	Intravenous injection of Bradykinin,Human blood sample	in vivo	None	None	Not mentioned
1708	10871321	2000	RPPGFSPFR	Bradykinin	9	Free	Free	Linear	L	None	Human blood plasma	Cardioprotective effects	Not reported	106 cpm/200Î¼l/mouse	Not measured as peptide degraded rapidly<30 approx.	Aminopeptidase P,Dipeptidyl-peptidaseIV,KininaseII,KininaseI and neutral endopeptidase	HPLC-ESI-MS	Human blood sample	in vivo	None	None	Not mentioned
1713	10454085	1999	CYIQNCPLG	Oxytocin	9	Free	Amidation	Cyclic (C1-C6)	L	None	Hypothalamus	Involved in aiding mechanical clearance mechanism and improving fertility	60 minutes	90mg	6.78	Blood protease	Radioimmunoassay	Intravenous injection of oxytocin in normal mares	in vivo	None	None	Prostaglandin F metabolite(PGFM) release on administeration of 10 iu of oxytocin= 18.48 ±3.62 pg/ml
1714	10454085	1999	CYIQNCPLG	Oxytocin	9	Free	Amidation	Cyclic (C1-C6)	L	None	Hypothalamus	Involved in aiding mechanical clearance mechanism and improving fertility	60 minutes	180mg	6.78	Blood protease	Radioimmunoassay	Intravenous injection of oxytocin in normal mares	in vivo	None	None	Prostaglandin F metabolite(PGFM) release on administeration of 25 iu of oxytocin= 20.09 ±3.29 pg/ml
1715	10544005	1999	YIGSR	YIGSR	5	Free	Free	Linear	L	None	Core sequence located at the Î²-1 chain of laminin	Antimetastatic effect.	Not reported	Not mentioned	<1	Blood protease	Radioactivity measured with a gamma counter	Intravenous injection of labelled peptide in C57BL/6 mice	in vivo	None	None	At 1.5Î¼mol reduced number of colonies of B16-BL6 melanoma cells in lung by 50%
1716	10544005	1999	YIGSR	PEG5000 -YIGSR	5	Pegylated by addition of PEG5000	Free	Linear	L	None	Core sequence located at the Î²-1 chain of laminin	Antimetastatic effect.	Not reported	Not mentioned	2.2	Blood protease	Radioactivity measured with a gamma counter	Intravenous injection of labelled peptide in C57BL/6 mice	in vivo	None	None	At 0.15Î¼mol reduced number of colonies of B16-BL6 melanoma cells in lung by 70% approx.
1717	10544005	2000	YIGSR	PEG12,000 -YIGSR	5	Pegylated by addition of PEG12,000	Free	Linear	L	None	Core sequence located at the Î²-1 chain of laminin	Antimetastatic effect.	Not reported	Not mentioned	2.5	Blood protease	Radioactivity measured with a gamma counter	Intravenous injection of labelled peptide in C57BL/6 mice	in vivo	None	None	At 0.15Î¼mol reduced number of colonies of B16-BL6 melanoma cells in lung by 50%
2077	8910426	1996	KPTFRRLKWK	LL:36 €“45	10	Free	Free	Linear	L	None	Analogue of Limulus anti-lipopolysaccharide factor	Antibacterial	Not reported	2.5 µg/ml	17	Proteases present in fetal calf serum	RP-HPLC	Fetal calf serum	in vitro	None	None	No cell lysis done by this peptide
2078	8910426	1996	GCTFRRLKWKCG	LALF-10 (38 €“45)	12	Free	Free	Cyclic (C2-C11)	L	None	Analogue of Limulus anti-lipopolysaccharide factor	Antibacterial	Not reported	2.5 µg/ml	77	Proteases present in fetal calf serum	RP-HPLC	Fetal calf serum	in vitro	None	None	LD50=2.58 mg/ml
2079	8910426	1996	GCKPTFRRLKWKYKCG	LALF-14 (36 €“47)	16	Free	Free	Cyclic (C2-C15)	L	None	Analogue of Limulus anti-lipopolysaccharide factor	Antibacterial	Not reported	2.5 µg/ml	84	Proteases present in fetal calf serum	RP-HPLC	Fetal calf serum	in vitro	None	None	LD50=2.33 mg/ml
2080	9067297	1996	YGGFLRRl	E-2078 [N-methyl-Tyr1, N-methyl-Arg7-D-Leu8] Dyn A (1 €“8) ethylamide]	N.A.	Methylation	Ethylamide	Linear	Mix	Methylation on Arg7 and Tyr1	Dynorphin A (1 €“ 8) analog	Analgesic	Not reported	10 mg/kg	44	Monkey blood proteases	MALDI-MS	Rhesus monkey blood plasma (Intravenous)	in vivo	7479294	None	Not available
2332	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2, 5, 15, 30, 45, and 60min	0.10mg/kg	1 (t1/2 Î±)	Rat blood plasma proteases	HPLC-MS	Intravenous administered to Rat	in vivo	None	None	Not tested
2333	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2,5,10,20,30,45,60,90,120,180,240,300,360, 480,600, and 1440min	0.10mg/kg	13 (t1/2 Î±)	Dog blood plasma proteases	HPLC-MS	Intravenous administered to Dog	in vivo	None	None	Not tested
2334	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2, 5, 10, 30, 60, 90, 120, 180, 240, 300, 360, 480, and 1440min	0.10mg/kg	4 (t1/2 Î±)	Rabbit blood plasma proteases	HPLC-MS	Intravenous administered to Rabbit	in vivo	None	None	Not tested
2335	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2, 5, 10, 30, 60, 90, 120, 180, 240, 300, 360, 480, and 1440min	0.10mg/kg	5 (t1/2 Î±)	Monkey blood plasma proteases	HPLC-MS	Intravenous administered to Monkey	in vivo	None	None	Not tested
2336	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2, 5, 15, 30, 45, and 60min	0.10mg/kg	15 (t1/2 Î²)	Rat blood plasma proteases	HPLC-MS	Intravenous administered to Rat	in vivo	None	None	Not tested
2337	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2,5,10,20,30,45,60,90,120,180,240,300,360, 480,600, and 1440min	0.10mg/kg	64 (t1/2 Î²)	Dog blood plasma proteases	HPLC-MS	Intravenous administered to Dog	in vivo	None	None	Not tested
2338	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2, 5, 10, 30, 60, 90, 120, 180, 240, 300, 360, 480, and 1440min	0.10mg/kg	64 (t1/2 Î²)	Rabbit blood plasma proteases	HPLC-MS	Intravenous administered to Rabbit	in vivo	None	None	Not tested
2339	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2, 5, 10, 30, 60, 90, 120, 180, 240, 300, 360, 480, and 1440min	0.10mg/kg	68 (t1/2 Î²)	Monkey blood plasma proteases	HPLC-MS	Intravenous administered to Monkey	in vivo	None	None	Not tested
2340	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min	5 mg/kg	73 (t1/2 Î²)	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2341	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	2,5,10,20,30,45,60,90,120,180,240,300,360, 480,600, and 1440min	5 mg/kg	45 (t1/2 Î²)	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2342	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min	5 mg/kg	51	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2343	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min	50 mg/kg	80	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2344	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min	300 mg/kg	99	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2345	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min	500 mg/kg	122	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2346	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min	1000 mg/kg	204	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2347	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	1 day	5 mg/kg	51	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2348	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	28 day	5 mg/kg	74	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2349	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	1 day	50 mg/kg	80	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2350	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	28 day	50 mg/kg	71	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2351	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	1 day	300 mg/kg	99	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2352	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	28 day	300 mg/kg	100	Rat blood plasma proteases	HPLC-MS	Orally administered to Rat	in vivo	None	None	Not tested
2353	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	1 day	5 mg/kg	45	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2354	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	28 day	5 mg/kg	44	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2355	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	1 day	50 mg/kg	48	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2356	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	28 day	50 mg/kg	50	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2357	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	1 day	300 mg/kg	75	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2358	8991489	1996	RPD	IRI-695 peptide	3	Acetylation	Isobutyl citrate	Linear	L	C14 Radiolabeling	Synthetic	Anxiolytic and antidepressant	28 day	300 mg/kg	76	Dog blood plasma proteases	HPLC-MS	Orally administered to Dog	in vivo	None	None	Not tested
2359	9062685	1997	pGlu-NC(C)PRG	[pGIu4,Cyt6]AVP(4-9)	6	Free	Amidation	Linear	L	pGlu = pyroglutamate	Human kidney cells	Antidiuretic hormone	5, 10, 30, 60 and 120 min	10 ng/kg	40	Rat blood proteases	HPLC	Subcutaneously injected to rat	in vivo	None	None	Passive avoidance test to check the learning behaviour and response latency is measured of movement from light compartement to dark compartement. The peptide decreased the latency period significantly and also effective at 100 fold lower cincentration than then other drugs.
2360	9062685	1997	NCPR	[Cys6]AVP(5-8)	4	Free	Free	Linear	L	At 2 position cystine is replaced by cysteine	Human kidney cells	Antidiuretic hormone	5, 10, 30, 60 and 120 min	1 ng/kg	10	Rat blood proteases	HPLC	Subcutaneously injected to rat	in vivo	None	None	Passive avoidance test to check the learning behaviour and response latency is measured of movement from light compartement to dark compartement. The peptide decreased the latency period significantly and also effective at 100 fold lower cincentration than then other drugs.
2361	9062685	1997	pGlu-NSPRG	No.302	6	Free	Amidation	Linear	L	pGlu = pyroglutamate	Human kidney cells	Antidiuretic hormone	5, 10, 30, 60 and 120 min	0.1, 1 and 10ng/kg	9	Rat blood proteases	HPLC	Subcutaneously injected to rat	in vivo	None	None	Passive avoidance test to check the learning behaviour and response latency is measured of movement from light compartement to dark compartement. The peptide decreased the latency period significantly and also effective at 100 fold lower cincentration than then other drugs.
2362	9062685	1997	NSPR	Analogue of [Cys6]AVP(5-8)	4	Free	Free	Linear	L	None	Human kidney cells	Antidiuretic hormone	5, 10, 30, 60 and 120 min	10 ng/kg	223	Rat blood proteases	HPLC	Subcutaneously injected to rat	in vivo	None	None	Passive avoidance test to check the learning behaviour and response latency is measured of movement from light compartement to dark compartement. The peptide decreased the latency period significantly and also effective at 100 fold lower cincentration than then other drugs.
2363	9357069	1997	rPKPfQwFwLL	[D-Arg1,D-Phe5,D-Trp7,9,Leu11]Substance P	11	Free	Amidation	Linear	Mix	None	Substance P	Neuropeptide growth factor antagonist	upto 360 minutes	12 µg/g body weight of mice	45.9 (terminal t1/2)	Mice blood proteases	RP-HPLC	Intraperitonial injection to Nu/Nu mice	in vivo	http://www.abcam.com/d-arg1d-phe5d-trp79leu11-subs	None	Not reported
2364	9421401	1998	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	Atrial Natriuretic peptide	28	Free	Free	Linear	L	None	Human Heart muscle cells	Antihypertensive	0.5, 1, 1.5, 2, 3, 5, 8, 15, and 25 min	2 Î¼g	0.8 ±0.1 (t1/2 fast phase)	Rat plasma proteases	Radioimmunoassay	Exogenously administered to Male SHR-SP/Izm rats treated with carvedilol	in vivo	None	None	ANP role in antihypertension and blood pressure is determined by injecting ANP peptide(8mg/kg of body weight) in carvedilol and control group. The systolic blood pressure was decreased after 1 week of treatment in carvedilol treated group.
2365	9421401	1998	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	Atrial Natriuretic peptide	28	Free	Free	Linear	L	None	Human Heart muscle cells	Antihypertensive	0.5, 1, 1.5, 2, 3, 5, 8, 15, and 25 min	2 Î¼g	0.9 ±0.1 (t1/2 fast phase)	Rat plasma proteases	Radioimmunoassay	Exogenously administered to Male SHR-SP/Izm rats	in vivo	None	None	ANP role in antihypertension and blood pressure is determined by injecting ANP peptide(8mg/kg of body weight) in carvedilol and control group. The systolic blood pressure was decreased after 1 week of treatment in carvedilol treated group.
2366	9421401	1998	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	Atrial Natriuretic peptide	28	Free	Free	Linear	L	None	Human Heart muscle cells	Antihypertensive	0.5, 1, 1.5, 2, 3, 5, 8, 15, and 25 min	2 Î¼g	7.7 ±0.8 (t1/2 slow phase)	Rat plasma proteases	Radioimmunoassay	Exogenously administered to Male SHR-SP/Izm rats treated with carvedilol	in vivo	None	None	ANP role in antihypertension and blood pressure is determined by injecting ANP peptide(8mg/kg of body weight) in carvedilol and control group. The systolic blood pressure was decreased after 1 week of treatment in carvedilol treated group.
2367	9421401	1998	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	Atrial Natriuretic peptide	28	Free	Free	Linear	L	None	Human Heart muscle cells	Antihypertensive	0.5, 1, 1.5, 2, 3, 5, 8, 15, and 25 min	2 Î¼g	4.9 ±0.5 (t1/2 slow phase)	Rat plasma proteases	Radioimmunoassay	Exogenously administered to Male SHR-SP/Izm rats	in vivo	None	None	ANP role in antihypertension and blood pressure is determined by injecting ANP peptide(8mg/kg of body weight) in carvedilol and control group. The systolic blood pressure was decreased after 1 week of treatment in carvedilol treated group.
2368	9589822	1998	Mpr-Har-GDWPC	Eptifibatide	7	Mpr=mercaptopropionyl	Amidation	Cyclic (disulfide bridge between cysteine and mercaptopropionyl)	L	None	Venom of pygmy rattlesnake	Antithrombotic	1.5, 2, 4, 6, 8, 12, 16, 24, 36, 48, 60, and 72 hours	135 Î¼g/kg	1.13 ±0.17 (t1/2 termination)	Human blood plasma proteases	HPLC	Intravenous injection to Human	in vitro	http://www.prospecbio.com/Eptifibatide_11_124/	None	Not tested
2369	9589822	1998	Mpr-Har-GDWPC	Eptifibatide	7	Mpr=mercaptopropionyl	Amidation	Cyclic (disulfide bridge between cysteine amide and mercaptopropionyl)	L	None	Venom of pygmy rattlesnake	Antithrombotic	1.5, 2, 4, 6, 8, 12, 16, 24, 36, 48, 60, and 72 hours	135 Î¼g/kg	5 ±2.5 (t1/2 distribution)	Human blood plasma proteases	HPLC	Intravenous injection to Human	in vitro	http://www.prospecbio.com/Eptifibatide_11_124/	None	Not tested
2370	9932163	1998	VVVPP	Cemadotin-HCl	5	Free	Free	Linear	L	None	Synthetic analogue of Dolastatin 15	Antimitotic	24 hour	10 - 27.5mg	10	Human blood proteases	Radioimmunoassay	Intravenous administration to human	in vivo	None	None	Cancer patient was administered with Cemadotin for 24 hours intravenously at dose of 10mg. Reduction in liver metastasis was observed by sonographic examination.
2371	10354413	1999	YGG	Thioimreg compound 11	3	Free	Free	Linear	L	Peptide bonds at position 1,2 was replaced by thioamide linkages	Thioanalogue of natural Imreg	Immunostimulant	3.5 hours	Not given	46	Rat blood proteases	HPLC	Rat whole blood	in vitro	None	None	125 mg/kg of 11 resulted in a significant increase in activated T helper cells (CD4+CD45+, 28%, P e 0.048). This is accompanied by a significant reduction in NK cells (20-27%, P e 0.02) at 50 and 100 mg/kg
2372	10354413	1999	YGG	Imreg	3	Free	Free	Linear	L	None	Human leucocyte	Immunostimulant and in clinical trial to treat AIDS	3.5 hours	Not given	<1	Rat blood proteases	HPLC	Rat whole blood	in vitro	None	None	Immunophenotyping assay is performed to study immunological effect like stimulation of NK cells and lymphoproliferative properties. T cell proliferation was observed at even at 100mg/kg
2373	10354413	1999	YGG	Thioimreg compound 8	3	Free	Free	Linear	L	Peptide bonds at position 2,3 was replaced by thioamide linkage	Thioanalogue of natural Imreg	Immunostimulant	3.5 hours	Not given	>180	Rat blood proteases	HPLC	Rat whole blood	in vitro	None	None	A weak in vitro induction of T (PHA) and B (PWM) cell proliferation (1.5 to 2-fold increase) by the thioanalogues
2374	10573295	1999	DPLPEF	Enkephalin	6	Free	Amidation	Linear	L	None	Natural (Human brain)	Analgesic	0, 60, 120, 180, and 300 min	1mM	30	Mouse plasma proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse plasma	in vitro	None	None	Not tested
2375	10573295	1999	DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	None	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse plasma proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse plasma	in vitro	None	None	Not tested
2376	10573295	1999	p-[Cl-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para chlorination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse plasma proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse plasma	in vitro	None	None	Not tested
2377	10573295	1999	p-[Br-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para bromination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse plasma proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse plasma	in vitro	None	None	Not tested
2378	10573295	1999	p-[F-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para florination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse plasma proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse plasma	in vitro	None	None	Not tested
2379	10573295	1999	p-[I-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para iodination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse plasma proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse plasma	in vitro	None	None	Not tested
2380	10573295	1999	DPLPEF	Enkephalin	6	Free	Amidation	Linear	L	None	Natural (Human brain)	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse brain proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse brain proteases	in vitro	None	None	Not tested
2381	10573295	1999	DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Hydroxylation of amino group of Phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse brain proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse brain proteases	in vitro	None	None	Not tested
2382	10573295	1999	p-[Cl-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para chlorination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse brain proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse brain proteases	in vitro	None	None	Not tested
2383	10573295	1999	p-[Br-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para bromination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse brain proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse brain proteases	in vitro	None	None	Not tested
2384	10573295	1999	p-[F-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para florination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse brain proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse brain proteases	in vitro	None	None	Not tested
2385	10573295	1999	p-[I-Phe4]DPLPEF	Enkephalin analog	6	Free	Free	Linear	L	Para iodination of amino group of phenylalanine	Derivative of Natural enkephalin	Analgesic	0, 60, 120, 180, and 300 min	1mM	>300	Mouse brain proteases	HPLC , reverse phase HPLC, Partition coefficient	Mouse brain proteases	in vitro	None	None	Not tested
2386	10708307	1999	HSDAVFTDNYTRLRKQMAVKKYLNSILN	Vasoactive intestinal peptide	28	Free	Free	Linear	L	I125 radiolabeling and encapsulation of VIP in Liposome	Porcine intestine	Relaxation of the airway smooth muscle, attenuation of acute inflammation, regulation of mucus secretion	1.5, 2.5, 5, 10, 15, 20, 30, 40, and 60 min	0.33 nM	5.29 ±0.62 (t1/2 elimination)	Rat plasma proteases	Not mentioned	Intravenously administration to rat plasma	in vivo	PMID 5450698	None	Not tested
2387	10708307	1999	HSDAVFTDNYTRLRKQMAVKKYLNSILN	Vasoactive intestinal peptide	28	Free	Free	Linear	L	I125 radiolabeling	Porcine intestine	Relaxation of the airway smooth muscle, attenuation of acute inflammation, regulation of mucus secretion	1.5, 2.5, 5, 10, 15, 20, 30, 40, and 60 min	0.33 nM	0.62 ±0.05 (t1/2 elimination)	Rat plasma proteases	Not mentioned	Intravenously administration to rat plasma	in vivo	PMID 5450698	None	Not tested
2388	10708307	1999	HSDAVFTDNYTRLRKQMAVKKYLNSILN	Vasoactive intestinal peptide	28	Free	Free	Linear	L	I125 radiolabeling and encapsulation of VIP in Liposome	Porcine intestine	Relaxation of the airway smooth muscle, attenuation of acute inflammation, regulation of mucus secretion	1.5, 2.5, 5, 10, 15, 20, 30, 40, and 60 min	0.33 nM	9.28 ±0.76 (t1/2 elimination)	Rat lung proteases	Not mentioned	Intravenously administration to rat lung	in vitro	PMID 5450698	None	Not tested
2389	10708307	1999	HSDAVFTDNYTRLRKQMAVKKYLNSILN	Vasoactive intestinal peptide	28	Free	Free	Linear	L	I125 radiolabeling	Porcine intestine	Relaxation of the airway smooth muscle, attenuation of acute inflammation, regulation of mucus secretion	1.5, 2.5, 5, 10, 15, 20, 30, 40, and 60 min	0.33 nM	3.18 ±0.22 (t1/2 elimination)	Rat lung proteases	Not mentioned	Intravenously administration to rat lung	in vitro	PMID 5450698	None	Not tested
2390	10973845	2000	MEPLGWQLTSGPNQEQVSPLTLLK	Alpha 2-antiplasmin (Î±2AP )	24	Free	Free	Linear	L	I125 radiolabeling	Human SERPINF2 gene	Clotting factor	2 hours	2 mg/ml	19	Mouse blood proteases	Not mentioned	Mouse blood fibrin clots	in vitro	None	None	Immunoblotting assay was done by taking 50 µL of fibrin clots with 2mg/ml of alpha2 AP and alpha2 AP peptide and cross linking was determined by electroblotting to PVDF membrane and detected by streptavidin-peroxidase.
2391	10973845	2000	NQEQVSPLTLLK	Alpha 2-antiplasmin peptide (Î±2AP13-24 )	12	Free	Free	Linear	L	Biotinylation at lysine residue(position 24)	Human SERPINF2 gene	Clotting factor	2 hours	0.5mMol/L	21	Mouse blood proteases	Not mentioned	Mouse blood fibrin clots	in vitro	None	None	Immunoblotting assay was done by taking 50 µL of fibrin clots with 2mg/ml of alpha2 AP and alpha2 AP peptide and cross linking was determined by electroblotting to PVDF membrane and detected by streptavidin-peroxidase.
2414	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	10 Î¼g/kg	5.9 ±2.5 (t1/2 Î±)	New Zeland female rabbits blood protease	Radioimmunoassay	Intravenous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2415	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	10 Î¼g/kg	106 ±22 (t1/2 Î²)	New Zeland female rabbits blood protease	Radioimmunoassay	Intravenous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2416	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	1 Î¼g/kg	6.6 ±2.7 (t1/2 Î±)	New Zeland female rabbits blood protease	Radioimmunoassay	Subcutaneous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2417	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	1 Î¼g/kg	112 ±41 (t1/2 Î²)	New Zeland female rabbits blood protease	Radioimmunoassay	Subcutaneous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2418	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	10 Î¼g/kg	5.3 ±1.1 (t1/2 Î±)	New Zeland female rabbits blood protease	Radioimmunoassay	Subcutaneous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2419	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	10 Î¼g/kg	103 ±19 (t1/2 Î²)	New Zeland female rabbits blood protease	Radioimmunoassay	Subcutaneous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2420	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	100 Î¼g/kg	7.8 ±2.0 (t1/2 Î±)	New Zeland female rabbits blood protease	Radioimmunoassay	Subcutaneous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2421	9040091	1997	pGlu-HWSYwLRP	Meterelin	9	Free	Ethylamide	Linear	Mix	pGlu=pyroglutamic acid	Gonadotropic cells in the anterior pituitary gland	Behavior influencing hormones	5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an	100 Î¼g/kg	173 ±13 (t1/2 Î²)	New Zeland female rabbits blood protease	Radioimmunoassay	Subcutaneous injected in New Zeland female rabbits	in vivo	None	None	Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days
2533	10607940	2000	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	Insulin-like growth factor-I (IGF-I)	70	Free	Free	Linear	L	I125 labeling	Human IGF-1	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	3.2 ±0.1 (t1/2Î±)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	632300	None	infusion of 125I-IGF-I into rats, 0 ·003 ±0 ·001% (mean ±S.E.M, n=6) of total infused, intact 125I-IGF-I had appeared per milliliter of wound fluid.
2534	10607940	2000	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	Insulin-like growth factor-I (IGF-I)	70	Free	Free	Linear	L	I125 labeling	Human IGF-1	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	4.9 ±0.02 (t1/2Î±)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	632300	None	infusion of 125I-IGF-I into rats, 0 ·003 ±0 ·001% (mean ±S.E.M, n=6) of total infused, intact 125I-IGF-I had appeared per milliliter of wound fluid.
2535	10607940	2000	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	LR(3) insulin-like growth factor-I (IGF-I)	83	Free	Free	Linear	L	I125 labeling	Analogue of IGF-I	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	2.8 ±0.1 (t1/2Î±)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	http://www.cellsciences.com/content/p-detail.asp?r	None	At 5 min 0 ·01 ± 0 ·001% (mean ± S.E.M, n = 6, P < 0 ·001) of total infused intact 125I-LR3IGF-I had appeared per milliliter of wound fluid.
2536	10607940	2000	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	LR(3) insulin-like growth factor-I (IGF-I)	83	Free	Free	Linear	L	I125 labeling	Analogue of IGF-I	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	4.6 ±0.5 (t1/2Î±)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	http://www.cellsciences.com/content/p-detail.asp?r	None	At 5 min 0 ·01 ± 0 ·001% (mean ± S.E.M, n = 6, P < 0 ·001) of total infused intact 125I-LR3IGF-I had appeared per milliliter of wound fluid.
2537	10607940	2000	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	Insulin-like growth factor-I (IGF-I)	70	Free	Free	Linear	L	I125 labeling	Human IGF-1	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	203 ±10.2 (t1/2Î²)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	632300	None	infusion of 125I-IGF-I into rats, 0 ·003 ±0 ·001% (mean ±S.E.M, n=6) of total infused, intact 125I-IGF-I had appeared per milliliter of wound fluid.
2538	10607940	2000	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	Insulin-like growth factor-I (IGF-I)	70	Free	Free	Linear	L	I125 labeling	Human IGF-1	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	185.4 ±4.7 (t1/2Î²)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	632300	None	infusion of 125I-IGF-I into rats, 0 ·003 ±0 ·001% (mean ±S.E.M, n=6) of total infused, intact 125I-IGF-I had appeared per milliliter of wound fluid.
2539	10607940	2000	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	LR(3) insulin-like growth factor-I (IGF-I)	83	Free	Free	Linear	L	I125 labeling	Analogue of IGF-I	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	111.1 ±3.9 (t1/2Î²)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	http://www.cellsciences.com/content/p-detail.asp?r	None	At 5 min 0 ·01 ± 0 ·001% (mean ± S.E.M, n = 6, P < 0 ·001) of total infused intact 125I-LR3IGF-I had appeared per milliliter of wound fluid.
2540	10607940	2000	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA	LR(3) insulin-like growth factor-I (IGF-I)	83	Free	Free	Linear	L	I125 labeling	Analogue of IGF-I	Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow	5, 30, 120 and 240 min	100 Î¼l	140.2 ±2.5 (t1/2Î²)	Rat blood proteases	Radioimmunoassay and bi-exponential equation that describes a two-compartment model	Intravenous bolus administration in Rat	in vivo	http://www.cellsciences.com/content/p-detail.asp?r	None	At 5 min 0 ·01 ± 0 ·001% (mean ± S.E.M, n = 6, P < 0 ·001) of total infused intact 125I-LR3IGF-I had appeared per milliliter of wound fluid.
3047	10377427	1999	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	ANP ( Atrial natriuretic peptide)	28	Free	Free	Cyclic (C7-C23)	L	None	Cardiac atria	cardiovascular homeostasis	Blood was collected after 0.5, 1.5,2.5, 4, 8, and 16 min after administration of the labeled peptide	0.2 µci/mouse of [125I]ANP	1.44 ±0.05	Npr3+/+ mice blood proteases	Radioimmunoassay	Npr3+/+ mice blood sample	in vivo	6230082	None	Blood pressure=118.7 ±1.9 mmHg
3048	10377427	2000	SLRRSSCFGGRMDRIGAQSGLGCNSFRY	ANP ( Atrial natriuretic peptide)	28	Free	Free	Cyclic (C7-C23)	L	None	Cardiac atria	cardiovascular homeostasis	Blood was collected after 0.5, 1.5,2.5, 4, 8, and 16 min after administration of the labeled peptide	0.2 µci/mouse of [125I]ANP	2.4 ±0.08	Npr3-/- mice blood proteases	Radioimmunoassay	Npr3-/- mice blood sample	in vivo	6230082	None	Blood pressure=110.4 ±2.3 mmHg
3050	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	500Î¼g/kg	21.6	Rats blood proteases	Radioimmunoassay	Intravenous injection of the peptide in Hans Wistar Male rat	in vivo	None	None	Platelet count increased from 1,504Ã—103/mm3 to 2,262Ã—103/mm3,Neutophil count increased from 941/mm3 to 19,802/mm3,Monocyte count increased from 160/mm3 to 7,917/mm3,Eosinophil count increased from 86/mm3 to 1067/mm3,Basophil count increased from 11/mm3 to 653/mm3,Lymphocyte count increased from 4,210/mm3 to 24,759/mm3,RBC count decreased form 7.05Ã—106/mm3 to 5.56Ã—106/mm3,Prothrombin time increased from 13.7 to 16.7 seconds.
3051	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	500Î¼g/kg	30.2	Rats blood proteases	Radioimmunoassay	Intravenous injection of the peptide in Hans Wistar Female rat	in vivo	None	None	Platelet count increased from 1,504Ã—103/mm3 to 2,262Ã—103/mm3,Neutophil count increased from 941/mm3 to 19,802/mm3,Monocyte count increased from 160/mm3 to 7,917/mm3,Eosinophil count increased from 86/mm3 to 1067/mm3,Basophil count increased from 11/mm3 to 653/mm3,Lymphocyte count increased from 4,210/mm3 to 24,759/mm3,RBC count decreased form 7.05Ã—106/mm3 to 5.56Ã—106/mm3,Prothrombin time increased from 13.7 to 16.7 seconds.
3052	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	1000Î¼g/kg	23	Rats blood proteases	Radioimmunoassay	Intravenous injection of the peptide in Hans Wistar Male rat	in vivo	None	None	Platelet count increased from 1,504Ã—103/mm3 to 2,243Ã—103/mm3,Neutophil count increased from 941/mm3 to 18,870/mm3,Monocyte count increased from 160/mm3 to 6,790/mm3,Eosinophil count increased from 86/mm3 to 810/mm3,Basophil count increased from 11/mm3 to 329/mm3,Lymphocyte count increased from 4,210/mm3 to 24,874/mm3,RBC count decreased form 7.05Ã—106/mm3 to 5.53Ã—106/mm3,Prothrombin time increased from 13.7 to 17.2 seconds.
3053	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	1000Î¼g/kg	20.4	Rats blood proteases	Radioimmunoassay	Intravenous injection of the peptide in Hans Wistar Female rat	in vivo	None	None	Platelet count increased from 1,504Ã—103/mm3 to 2,243Ã—103/mm3,Neutophil count increased from 941/mm3 to 18,870/mm3,Monocyte count increased from 160/mm3 to 6,790/mm3,Eosinophil count increased from 86/mm3 to 810/mm3,Basophil count increased from 11/mm3 to 329/mm3,Lymphocyte count increased from 4,210/mm3 to 24,874/mm3,RBC count decreased form 7.05Ã—106/mm3 to 5.53Ã—106/mm3,Prothrombin time increased from 13.7 to 17.2 seconds.
3054	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	2000Î¼g/kg	18.2	Rats blood proteases	Radioimmunoassay	Intravenous injection of the peptide in Hans Wistar Male rat	in vivo	None	None	Platelet count increased from 1,504Ã—103/mm3 to 2,304Ã—103/mm3,Neutophil count increased from 941/mm3 to 27,439/mm3,Monocyte count increased from 160/mm3 to 8,246/mm3,Eosinophil count increased from 86/mm3 to 986/mm3,Basophil count increased from 11/mm3 to 863/mm3,Lymphocyte count increased from 4,210/mm3 to 27,439/mm3,RBC count decreased form 7.05Ã—106/mm3 to 5.52Ã—106/mm3,Prothrombin time increased from 13.7 to 17.5 seconds.
3055	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	2000Î¼g/kg	19.4	Rats blood proteases	Radioimmunoassay	Intravenous injection of the peptide in Hans Wistar Female rat	in vivo	None	None	Platelet count increased from 1,504Ã—103/mm3 to 2,304Ã—103/mm3,Neutophil count increased from 941/mm3 to 27,439/mm3,Monocyte count increased from 160/mm3 to 8,246/mm3,Eosinophil count increased from 86/mm3 to 986/mm3,Basophil count increased from 11/mm3 to 863/mm3,Lymphocyte count increased from 4,210/mm3 to 27,439/mm3,RBC count decreased form 7.05Ã—106/mm3 to 5.52Ã—106/mm3,Prothrombin time increased from 13.7 to 17.5 seconds.
3056	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	10Î¼g/kg	37	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3057	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	2Î¼g/kg	68	Monkey blood proteases	Radioimmunoassay	Subcutaneous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3058	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	10Î¼g/kg	47	Monkey blood proteases	Radioimmunoassay	Subcutaneous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3059	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	25Î¼g/kg	45	Monkey blood proteases	Radioimmunoassay	Subcutaneous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3060	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	100Î¼g/kg	45	Monkey blood proteases	Radioimmunoassay	Subcutaneous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3061	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	2Î¼g/kg	39	Monkey blood proteases	Radioimmunoassay	Subcutaneous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3062	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	Not reported	10Î¼g/kg	45	Monkey blood proteases	Radioimmunoassay	Subcutaneous injection in cynomolgus monkeys	in vivo	None	None	Not mentioned
3063	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	500Î¼g/kg following dose 1	26.1	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus male monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 1,811Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 6,900/mm3,Monocyte count increased from 450/mm3 to 1,150/mm3,Eosinophil count increased from 150/mm3 to 450/mm3,Lymphocyte count increased from 5,900/mm3 to 9,400/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.53Ã—106/mm3,Prothrombin time increased from 19.8 to 21.2 seconds.
3064	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	500Î¼g/kg following dose 1	25.4	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus female monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 1,811Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 6,900/mm3,Monocyte count increased from 450/mm3 to 1,150/mm3,Eosinophil count increased from 150/mm3 to 450/mm3,Lymphocyte count increased from 5,900/mm3 to 9,400/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.53Ã—106/mm3,Prothrombin time increased from 19.8 to 21.2 seconds.
3065	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	1000Î¼g/kg following dose 1	23.4	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus male monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,820Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 7,300/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 800/mm3,Lymphocyte count increased from 5,900/mm3 to 8,100/mm3,RBC count increased form 5.96Ã—106/mm3 to 6.16Ã—106/mm3,Prothrombin time increased from 19.8 to 21.7 seconds.
3066	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	1000Î¼g/kg following dose 1	23.7	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus female monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,820Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 7,300/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 800/mm3,Lymphocyte count increased from 5,900/mm3 to 8,100/mm3,RBC count increased form 5.96Ã—106/mm3 to 6.16Ã—106/mm3,Prothrombin time increased from 19.8 to 21.7 seconds.
3067	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	2000Î¼g/kg following dose 1	33.8	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus male monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,405Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 5,700/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 350/mm3,Lymphocyte count increased from 5,900/mm3 to 11,300/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.87Ã—106/mm3,Prothrombin time increased from 19.8 to 23.3 seconds.
3068	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	2000Î¼g/kg following dose 1	24.2	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus female monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,405Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 5,700/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 350/mm3,Lymphocyte count increased from 5,900/mm3 to 11,300/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.87Ã—106/mm3,Prothrombin time increased from 19.8 to 23.3 seconds.
3069	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	500Î¼g/kg following dose 14	27.2	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus male monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 1,811Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 6,900/mm3,Monocyte count increased from 450/mm3 to 1,150/mm3,Eosinophil count increased from 150/mm3 to 450/mm3,Lymphocyte count increased from 5,900/mm3 to 9,400/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.53Ã—106/mm3,Prothrombin time increased from 19.8 to 21.2 seconds.
3070	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	500Î¼g/kg following dose 14	32.7	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus female monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 1,811Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 6,900/mm3,Monocyte count increased from 450/mm3 to 1,150/mm3,Eosinophil count increased from 150/mm3 to 450/mm3,Lymphocyte count increased from 5,900/mm3 to 9,400/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.53Ã—106/mm3,Prothrombin time increased from 19.8 to 21.2 seconds.
3071	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	1000Î¼g/kg following dose 14	44	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus male monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,820Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 7,300/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 800/mm3,Lymphocyte count increased from 5,900/mm3 to 8,100/mm3,RBC count increased form 5.96Ã—106/mm3 to 6.16Ã—106/mm3,Prothrombin time increased from 19.8 to 21.7 seconds.
3072	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	1000Î¼g/kg following dose 14	25.1	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus female monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,820Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 7,300/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 800/mm3,Lymphocyte count increased from 5,900/mm3 to 8,100/mm3,RBC count increased form 5.96Ã—106/mm3 to 6.16Ã—106/mm3,Prothrombin time increased from 19.8 to 21.7 seconds.
3073	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	2000Î¼g/kg following dose 14	39.3	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus male monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,405Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 5,700/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 350/mm3,Lymphocyte count increased from 5,900/mm3 to 11,300/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.87Ã—106/mm3,Prothrombin time increased from 19.8 to 23.3 seconds.
3074	10606160	1999	(IEGPTLRQ-Npa-LAAR-Sar)2K	GW395058	29	Pegylated with 20,000 mw PEG [CH30(CH2CH2O)nCH@CH2C=O]	Amidation	Linear (branched)	L	Npa-napthylalanine,Sar-sarcosine	AF15705(substituted thrombopoietin mimetic peptide)	Treatment of thrombocytopenia	48 hours	2000Î¼g/kg following dose 14	31.3	Monkey blood proteases	Radioimmunoassay	Intravenous injection in cynomolgus female monkey	in vivo	None	None	Platelet count increased from 381Ã—103/mm3 to 2,405Ã—103/mm3,Neutophil count increased from 4,400/mm3 to 5,700/mm3,Monocyte count increased from 450/mm3 to 1,550/mm3,Eosinophil count increased from 150/mm3 to 350/mm3,Lymphocyte count increased from 5,900/mm3 to 11,300/mm3,RBC count decreased form 5.96Ã—106/mm3 to 5.87Ã—106/mm3,Prothrombin time increased from 19.8 to 23.3 seconds.