Peplife 2.0 - Browse by Length

Browsing by Length: Length Not Available

Browse Results:

Filter by Year
From
Upto

ID	PMID	YEAR	Sequence	Name	Length	N-ter MOD	C-ter MOD	Linear/Cyclic	Chirality	Chem-MOD	Origin	Nature	Incubation Time	Concentration	Half Life	Protease	Assay	Test Sample	Vivo/Vitro	Reference	Patent No.	Activity
4019	38737283	2024	LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP-FRRG-(E5C3)-(GN)	ABD035-immunoGN	None	P1h3	His-tag	Linear	L	Humanized anti-HER2 scFv P1h3, albumin-binding peptides (ABD035 or dAb7h8), cathepsin B-cleavable peptide B2, endosome-disruptive peptide E5C3 fusion protein, GN= Gasdermin-N	Synthetic	Antitumor	Blood samples were promptly collected at 5, 10, 30, 60, 360, and 720 min	0.1 μmol/kg	35.22	BALB/c mice serum protease	ELISA	BALB/c mice serum	In Vivo	None	None	Cytotoxicity of ABD035-immunoGN in N87 cells reached as high as 62 %, compared to 38 % for immunotBid after 24 h of incubation
4020	38737283	2024	FRRG-(E5C3)-(GN)	immunoGN	None	P1h3	His-tag	Linear	L	Humanized anti-HER2 scFv P1h3, albumin-binding peptides (ABD035 or dAb7h8), cathepsin B-cleavable peptide B2, endosome-disruptive peptide E5C3 fusion protein, GN= Gasdermin-N	Synthetic	Antitumor	Blood samples were promptly collected at 5, 10, 30, 60, 360, and 720 min	0.1 μmol/kg	4.599	BALB/c mice serum protease	ELISA	BALB/c mice serum	In Vivo	None	None	Cytotoxicity of ABD035-immunoGN in N87 cells reached as high as 62 %, compared to 38 % for immunotBid after 24 h of incubation
4021	38737283	2024	DIQMTQSPSSLSAVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYRNSPLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTYRVPPTFGQGTKVEIKR-FRRG-(E5C3)-(GN)	dAb7h8-immunoGN	None	P1h3	His-tag	Linear	L	Humanized anti-HER2 scFv P1h3, albumin-binding peptides (ABD035 or dAb7h8), cathepsin B-cleavable peptide B2, endosome-disruptive peptide E5C3 fusion protein, GN= Gasdermin-N	Synthetic	Antitumor	Blood samples were promptly collected at 5, 10, 30, 60, 360, and 720 min	0.1 μmol/kg	31.25	BALB/c mice serum protease	ELISA	BALB/c mice serum	In Vivo	None	None	Cytotoxicity of ABD035-immunoGN in N87 cells reached as high as 62 %, compared to 38 % for immunotBid after 24 h of incubation
4048	38399408	2024	None	BI-X	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment Of Human Ocular Disease	serial blood samples were taken in EDTA anticoagulant pre-dose and at 1 h, 2 h, 4 h, 24 h, 48 h, 72 h, 96 h, and 168 h and 2, 4, 6, 8, and 10 weeks after dosing or until the last in-life timepoint of the animals.	0.25 mg/eye	3	Cynomolgus Monkeys Plasma Protease	Immunocapture-LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	Affinity binding site to human albumin (KD = 1.4 nM)
4049	38399408	2024	None	BI-X	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment Of Human Ocular Disease	serial blood samples were taken in EDTA anticoagulant pre-dose and at 1 h, 2 h, 4 h, 24 h, 48 h, 72 h, 96 h, and 168 h and 2, 4, 6, 8, and 10 weeks after dosing or until the last in-life timepoint of the animals.	0.25 mg/eye	13.2	Cynomolgus Monkeys Plasma Protease	Immunocapture-LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	Affinity binding site to human albumin (KD = 1.4 nM)
4050	38399408	2024	None	BI-X	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment Of Human Ocular Disease	serial blood samples were taken in EDTA anticoagulant pre-dose and at 1 h, 2 h, 4 h, 24 h, 48 h, 72 h, 96 h, and 168 h and 2, 4, 6, 8, and 10 weeks after dosing or until the last in-life timepoint of the animals.	0.25 mg/eye	11.8	Cynomolgus Monkeys Plasma Protease	Immunocapture-LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	Affinity binding site to human albumin (KD = 1.4 nM)
4118	38863646	2024	None	(89Zr, Mn)-WPMNs	None	Free	Free	Linear	L	Mn and 89Zr labeling, MNPs modified with WL12-SH	WL12 derivative	Targets PD-L1	Blood samples were collected from orbital vein at 1, 3, 5, 10, 15, 20, 30, 45 min and 1, 1.5, 2, 3, 4, 14, 24, 48, 72, 96 h	0.5 mg/ml	0.1234 (Fast) (Metabolic Half Life)	KM mouse blood protease	Radioactivity assay using γ-counter	KM mouse blood	In Vivo	None	None	N.A.
4119	38863646	2024	None	(89Zr, Mn)-WPMNs	None	Free	Free	Linear	L	Mn and 89Zr labeling, MNPs modified with WL12-SH	WL12 derivative	Targets PD-L1	Blood samples were collected from orbital vein at 1, 3, 5, 10, 15, 20, 30, 45 min and 1, 1.5, 2, 3, 4, 14, 24, 48, 72, 96 h	0.5 mg/ml	1.554 (Slow) (Distribution Half Life)	KM mouse blood protease	Radioactivity assay using γ-counter	KM mouse blood sample	In Vivo	None	None	N.A.
4120	38697423	2024	None	DAE Rum55	None	N.A.	N.A.	N.A.	D	N.A.	Ruminococcus sp. CAG55	Epimerase	50 °C	N.A.	4.5 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	D-allulose/D-psicose 3-epimerase (DAE/DPE, EC 5.1.3.30) and D-tagatose 3-epimerase (DTE, EC 5.1.3.31), of which DAE usually exhibits higher catalytic activity
4121	38697423	2024	None	E268R-EKL16	None	N.A.	N.A.	N.A.	N.A.	N.A.	Ruminococcus sp. CAG55 derivative	Epimerase	50 °C	N.A.	135.3 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	D-allulose/D-psicose 3-epimerase (DAE/DPE, EC 5.1.3.30) and D-tagatose 3-epimerase (DTE, EC 5.1.3.31), of which DAE usually exhibits higher catalytic activity
4122	38753095	2024	None	Xyn10-HB	None	N.A.	N.A.	N.A.	N.A.	N.A.	GH10 xylanase from Halalkalibacterium halodurans C-125	GH10 xylanase	pH 8.5 and 60 °C	N.A.	3 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	Xyn10-HB produced active XOS with antioxidant activity determined by the DPPH radical scavenging method (IC50 of 0.54 mg/mL after 4 h)
4123	38115231	2024	None	Trx1P	None	N.A.	N.A.	Linear	L	N.A.	Derived from E. coli thioredoxin (Trx).	N.A.	N.A.	N.A.	124 ± 15 (T1/2 Cis-Trans Isomerizations)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4124	38115231	2024	None	Trx1Thp	None	N.A.	N.A.	Linear	L	Incorporation of 4-thiaproline (Thp) at position cisPro76	Derived from E. coli thioredoxin (Trx).	N.A.	N.A.	N.A.	33 ± 3 (T1/2 Cis-Trans Isomerizations)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4178	37875481	2023	None	IL-15-Cy7	None	Free	Free	Linear	L	Cy7	Derived from Interleukin-15	Antitumor	The blood sample was harvested at timed intervals (2 min, 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, 12 h, and 24 h)	N.A.	0.69	Mice blood protease	Fluorescence spectrophotometry	Mice blood	In Vivo	None	None	Not mentioned
4179	37875481	2023	None	biNV-IL-15-Cy7	None	Free	Free	Linear	L	Cy7	Derived from Interleukin-15	Antitumor	The blood sample was harvested at timed intervals (2 min, 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, 12 h, and 24 h)	N.A.	5.66	Mice blood protease	Fluorescence spectrophotometry	Mice blood	In Vivo	None	None	Not mentioned
4388	37329900	2023	None	KAN-101	None	N.A.	N.A.	N.A.	N.A.	Liver-targeting glycosylation signature conjugated to a deaminated gliadin peptide	N.A.	Liver-Targeted Immune Tolerance Therapy	N.A.	0·15 mg/kg, 0·3 mg/kg, 0·6 mg/kg, 1·2 mg/kg, 1·5 mg/kg	3·72 to 31·72	Human protease	N.A.	Human	In Vivo	None	None	N.A.
4520	36075899	2022	None	S-20-1	None	N.A.	N.A.	Cyclic	L	Modified by adding negative charge	Synthetic	Antiviral (Against Infection By Sars-Cov-2 )	Blood samples were collected at 10 min, 20 min, 30 min, 1 h, 2 h, 4 h, 8 h, 24 h and 48 h	50 mg/kg	14.53 (Terminal Elimination Half Life)	C57Bl/6 mice plasma protease	LC-MS/MS	C57BL/6 mice plasma	In Vivo	None	None	IC50 (μM) = 0.8 in HUH 7 cells
4521	36075899	2022	None	S-20-1	None	N.A.	N.A.	Cyclic	L	Modified by adding negative charge	Synthetic	Antiviral (Against Infection By Sars-Cov-2 )	Blood samples were collected at 10 min, 20 min, 30 min, 1 h, 2 h, 4 h, 8 h, 24 h and 48 h	50 mg/kg	24.29 (Terminal Elimination Half Life)	C57Bl/6 mice plasma protease	LC-MS/MS	C57BL/6 mice plasma	In Vivo	None	None	IC50 (μM) = 0.8 in HUH 7 cells
4522	36047255	2022	H-r-Dmt-KF-PEG-DSPE, c(RGD)-PEG-DSPE	MTP/RGD-CAL/TAN NS	None	Free	MTP/RGD comodified with CAL/TAN NS	Linear	L(cRGD), Mix(MTP)	Dmt: 2',6'-dimethyltyrosine	Synthetic	Treatment of Acute Myocardial Infarction (Ami)	Blood samples were obtained at determined times until 72 h after injection and 15 μL of heparin (1000 U/mL) was added to each sample	10 mg/kg	8.22	AMI rats plasma protease	N.A.	AMI rats plasma	In Vivo	None	None	Blank MTP/RGD NS and RGD-PEG-DSPE groups showed over 85% of cell viability. In contrast, drugs contained formulations exhibited cytotoxicity to some extent
4719	EP 2021080747 W	2022	None	Test 1	None	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	100 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4720	EP 2021080747 W	2022	None	Test 2	None	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	101 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4721	EP 2021080747 W	2022	None	Test 3	None	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	105 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4722	EP 2021080747 W	2022	None	Test 4	None	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	109 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4755	35910276	2022	None	BA17	None	Free	Free	Linear	L	None	Isolated from B. licheniformis	Serine protease	50°C	N.A.	90 (Enzyme Activity)	N.A.	Zymography	N.A.	In Vitro	None	None	N.A.
4756	35910276	2022	None	BA17	None	Free	Free	Linear	L	None	Isolated from B. licheniformis	Serine protease	60 °C	N.A.	12 (Enzyme Activity)	N.A.	Zymography	N.A.	In Vitro	None	None	N.A.
4763	35488338	2022	None	FRAP-smTG	None	Frap (A Fusion Tag)	Free	Linear	L	None	TGm1 variant	Used to generate protein crosslinking or attachment of small molecules	60 ℃	0.4 mg/mL	< 2 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4764	35488338	2022	None	FRAP-TGm1	None	Frap (A Fusion Tag)	Free	Linear	L	None	TGm1 variant	Used to generate protein crosslinking or attachment of small molecules	60 ℃	0.4 mg/mL	11.31 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4765	35488338	2022	None	FRAPD-TGm1	None	Frap (A Fusion Tag)	Free	Linear	L	additional modification (Asp residue)	TGm1 variant	Used to generate protein crosslinking or attachment of small molecules	60 ℃	0.4 mg/mL	21.97 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4770	35133860	2022	None	E187A	None	Free	Free	Linear	L	Residue Glu187 of the Ca1 site in the catalytic domain was replaced by Ala	Derived from preTSS	Collagenolytic protease	70°C	N.A.	N.A.	N.A.	N.A.	N.A.	In Viro Study	None	None	When the residue Glu187 of the Ca1 site in the catalytic domain was replaced by Ala, the resulting variant E187A was completely inactivated after incubation at 70°C for 3 h
4968	33665501	2021	Poly(L-glutamic acid)	PLG-Pt	None	Free	Cisplatin (CDDP) is complexed with the carboxyl groups of the L-glutamic acid	Linear	L	None	Synthetic	Anticancer	At predefined time points 5, 15, and 30 min, and 1, 3, 6, 12, and 24 h, 200.0 μL of blood samples were collected from the orbital cavities of rats	3 mg/kg	1.9	Rats plasma protease	ICP-MS	Rats plasma	In Vivo	None	None	IC50 (μg mL−1) = 4.8 in SKOV3 cells
4969	33665501	2021	Poly(L-glutamic acid)	PEG-PLG-Pt	None	PEGylation	Cisplatin (CDDP) is complexed with the carboxyl groups of the L-glutamic acid	Linear	L	PEGylation	Synthetic	Anticancer	At predefined time points 5, 15, and 30 min, and 1, 3, 6, 12, and 24 h, 200.0 μL of blood samples were collected from the orbital cavities of rats	3 mg/kg	8.8	Rats plasma protease	ICP-MS	Rats plasma	In Vivo	None	None	IC50 (μg mL−1) = 11 in SKOV3 cells
4970	33665501	2021	Poly(L-glutamic acid)	PEG-pHe-PLG-Pt (pH 7.4)	None	PEG-CDM	Cisplatin (CDDP) is complexed with the carboxyl groups of the L-glutamic acid	Linear	L	Poly(L-glutamic acid) is grafted with methoxy poly(ethylene glycol) (PEG) using a pH-sensitive linker, 2-propionic-3-methylmaleic anhydride = CDM	Synthetic	Anticancer	At predefined time points 5, 15, and 30 min, and 1, 3, 6, 12, and 24 h, 200.0 μL of blood samples were collected from the orbital cavities of rats	3 mg/kg	7.9	Rats plasma protease	ICP-MS	Rats plasma	In Vivo	None	None	IC50 (μg mL−1) = 8.5 in SKOV3 cells
4971	33665501	2021	Poly(L-glutamic acid)	PEG-pHe-PLG-Pt (pH 6.5)	None	PEG-CDM	Cisplatin (CDDP) is complexed with the carboxyl groups of the L-glutamic acid	Linear	L	Poly(L-glutamic acid) is grafted with methoxy poly(ethylene glycol) (PEG) using a pH-sensitive linker, CDM = 2-propionic-3-methylmaleic anhydride	Synthetic	Anticancer	At predefined time points 5, 15, and 30 min, and 1, 3, 6, 12, and 24 h, 200.0 μL of blood samples were collected from the orbital cavities of rats	3 mg/kg	N.A.	Rats plasma protease	ICP-MS	Rats plasma	In Vivo	None	None	IC50 (μg mL−1) = 5.8 in SKOV3 cells
4972	33665501	2021	PLGLAG-Poly(L-glutamic acid)	PEG-MMP-PLG-Pt	None	PEGylation	Cisplatin (CDDP) is complexed with the carboxyl groups of the L-glutamic acid	Linear	L	PEGylation through an MMP-sensitive peptide linker (PLGLAG), CDM = 2-propionic-3-methylmaleic anhydride	Synthetic	Anticancer	At predefined time points 5, 15, and 30 min, and 1, 3, 6, 12, and 24 h, 200.0 μL of blood samples were collected from the orbital cavities of rats	3 mg/kg	7.8	Rats plasma protease	ICP-MS	Rats plasma	In Vivo	None	None	IC50 (μg mL−1) = 6.9 in SKOV3 cells
5229	32034289	2020	VL-GGGGSGGGGSGGGGS-VH-GGGGS-KPLPEVTDEY	α-GD2 scFv TM	None	Radiolabelled with 64Cu	E5B9	Linear	L	VH and VL joined by linker (GGGGS)3	Synthetic	Antitumor	N.A.	N.A.	1.6	Mice blood protease	PET scanning	Mice blood sample	In Vivo	E5B9 sequence available on this link: https://pmc.ncbi.nlm.nih.gov/articles/PMC6805801/	None	EC50 = 0.7 nM (target cell lysis)
5282	32454120	2020	None	Uox-WT	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	1.1 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5283	32454120	2020	None	Uox-HSA	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	17.4 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5284	32454120	2020	None	PEG-PAEU + Uox-HSA	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	43.6 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5285	32454120	2020	None	PEG-PAEU-ABP + Uox-HSA	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	96.3 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5337	31453257	2019	None	Pept. A	None	Free	Free	Cyclic	L	N.A.	N.A.	Therapeutic agent against a CNS-related disorder	Blood (100 µl) and CSF (100 µl) aliquots for drug concentration assessment were collected pre-dose, on study day 1 at 0.5, 1.5, 3, 6, and 24 h post first dose, and on study day 2 at 1.5 h post the second dose (corresponding to 25.5 h from study start)	4.2 mg/kg	3.5 ± 0.7 (Terminal Half Life)	Göttingen minipigs plasma protease	LC-MS/MS	Göttingen minipigs plasma	In Vivo	None	None	N.A.
5338	31453257	2019	None	Pept. A	None	Free	Free	Cyclic	L	N.A.	N.A.	Therapeutic agent against a CNS-related disorder	Blood (100 µl) and CSF (100 µl) aliquots for drug concentration assessment were collected pre-dose, on study day 1 at 0.5, 1.5, 3, 6, and 24 h post first dose, and on study day 2 at 1.5 h post the second dose (corresponding to 25.5 h from study start)	4.2 mg/kg	14.3 ± 5.5 (Terminal Half Life)	göttingen Minipig Csf Lumbar Protease	LC-MS/MS	Göttingen minipigs CSF lumbar	In Vivo	None	None	N.A.
5601	30344018	2019	None	ASN	None	N.A.	N.A.	N.A.	N.A.	N.A.	B. cereus BDRD-ST26 (P43-amyE-BcA)	Production of acrylamide-free food	50 C	N.A.	17.35 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	Km = 9.38 mM
5602	30344018	2019	None	ASN	None	N.A.	N.A.	N.A.	N.A.	N.A.	B. cereus BDRD-ST26 (P43-BcA)	Production of acrylamide-free food	50 C	N.A.	17.57 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	km = 9.41 mM
5603	30344018	2019	None	ASN	None	N.A.	N.A.	N.A.	N.A.	N.A.	B. subtilis 168	Production of acrylamide-free food	65 C	N.A.	61 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	km = 5.3 mM
5604	30344018	2019	None	ASN	None	N.A.	N.A.	N.A.	N.A.	N.A.	T. kodakaraensis 1656	Production of acrylamide-free food	85 C	N.A.	130 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	km = 5.5 mM
5631	30809901	2019	None	FITC-AAR029b	None	Fluorescein isothiocynate labeled	Free	Macrocyclic	L	None	Derived from a class of peptides known as cyclic peptide triazoles (cPTs)	Antiviral	N.A.	0.01 mg/kg	0.029 ± 0.01 (T1/2Α-Distribution Half Life)	Rats plasma protease	Fluorescence assay	Rats plasma	In Vivo	None	None	EC50(nM) = 210±16 for AAR029b in Bal.01 virus
5632	30809901	2019	None	FITC-AAR029b in Liposome	None	Fluorescein isothiocynate labeled	Free	Macrocyclic	L	None	Derived from a class of peptides known as cyclic peptide triazoles (cPTs)	Antiviral	N.A.	0.01 mg/kg	0.032 ± 0.005 (T1/2Α-Distribution Half Life)	Rats plasma protease	Fluorescence assay	Rats plasma	In Vivo	None	None	EC50(nM) = 210±16 for AAR029b in Bal.01 virus
5875	29335522	2018	None	PAK2	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Role in PDAC cancer invasion and metastasis	N.A.	N.A.	4.5	Miapaca-2 cell lysate protease	Western blotting	Miapaca-2 cells lysate after PKM2 depletion (treated with 20 μg/ml cycloheximide (CHX))	In Vitro	None	None	N.A.
5876	29335522	2018	None	PAK2	None	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Role in PDAC cancer invasion and metastasis	N.A.	N.A.	>24	Miapaca-2 cell lysate protease	Western blotting	Miapaca-2 cells lysate with PKM2 expression (treated with 20 μg/ml cycloheximide (CHX))	In Vitro	None	None	N.A.
5916	29633613	2018	None	ThXylC	None	Free	Free	Linear	L	None	Obtained from the soluble fractions of the recombinant E. coli BL21(DE3) cells	β-xylosidase	65 °C	N.A.	8.9 (Activity Half Life)	N.A.	N.A.	ThXylC	In Vitro	None	None	N.A.
5917	29633613	2018	None	ThXylC-ELK	None	Free	ELK16 short peptide was introduced to the C-terminus of ThXylC	Linear	L	None	Obtained from the soluble fractions of the recombinant E. coli BL21(DE3) cells	β-xylosidase	65 °C	N.A.	54.8 (Activity Half Life)	N.A.	N.A.	ThXylC-ELK	In Vitro	None	None	N.A.
5922	29373818	2018	None	fibrinolytic enzyme	None	N.A.	N.A.	N.A.	N.A.	N.A.	From the marine Serratia marcescens subsp sakuensis	Clot lysis	37 °C	N.A.	19 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	N.A.
5923	29373818	2018	None	fibrinolytic enzyme	None	N.A.	N.A.	N.A.	N.A.	N.A.	From the marine Serratia marcescens subsp sakuensis	Clot lysis	50°C	N.A.	29 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	N.A.
5979	28714475	2017	EYEK(C14)EYE-(PEG24)3-XCFRLPCRQLRC	tag-3xPEG24-FXIIa inhibitor	None	Tag-3xPEG24	Amidation	Bi-Cyclic(C2-7, C7-C12 Disulfide Bond In Fxiia Inhibitor)	L	None	Synthetic	FXIIa Inhibitor	N.A.	5 mg/kg	1.0 ± 0.2 (T1/2a)	Rabbit plasma protease	RP-HPLC using fluorescence detector	Rabbit plasma	In Vivo	None	None	(EC5x) at 4.2±0.5 mM
5980	28714475	2017	EYEK(C14)EYE-(PEG24)3-XCFRLPCRQLRC	tag-3xPEG24-FXIIa inhibitor	None	Tag-3xPEG24	Amidation	Bi-Cyclic(C2-7, C7-C12 Disulfide Bond In Fxiia Inhibitor)	L	None	Synthetic	FXIIa Inhibitor	N.A.	5 mg/kg	5.2 ± 0.4 (T1/2b)	Rabbit plasma protease	RP-HPLC using fluorescence detector	Rabbit plasma	In Vivo	None	None	(EC5x) at 4.2±0.5 mM
6047	28068664	2017	None	scFv57R	None	Free	Free	Linear	L	None	Synthetic	Antiviral (against Rabies Virus)	37o C for 0-72 hours	0.5 mg/ml	14.1	N.A.	ELISA	PBS	In Vitro	None	None	Neutralizing potency (IU/ml) = 83.8 ± 9.4 for monomer
6078	27689406	2017	None	X1	None	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Antiobesity	N.A.	N.A.	3.9	Surgical rats plasma protease (Wistar Rat)	RIA	Surgical rats plasma (Wistar rat)	In Vivo	None	None	N.A.
6079	27689406	2017	None	X2	None	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Antiobesity	N.A.	N.A.	16.1	Surgical rats plasma protease (Wistar Rat)	RIA	Surgical rats plasma (Wistar rat)	In Vivo	None	None	N.A.
6080	27689406	2017	None	X3	None	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Antiobesity	N.A.	N.A.	21.3	Surgical rats plasma protease (Wistar Rat)	RIA	Surgical rats plasma (Wistar rat)	In Vivo	None	None	N.A.
6259	076-262-596-914-468	2016	None	GLP-1 ELP1-120	None	His7 of GLP1	Free	Linear	L	Fusion with ELP	preproglucagon	N.A.	N.A.	10mg/kg	12.9	Tev protease	Bioassay	Rat	in vivo	https://www.lens.org/lens/patent/076-262-596-914-468	US 9,458,218 B2	N.A.
6260	076-262-596-914-468	2016	None	GLP-1 ELP1-120	None	His7 of GLP1	Free	Linear	L	Fusion with ELP	preproglucagon	N.A.	N.A.	1 mg/kg	20	Tev protease	Bioassay	Rabbit	in vivo	https://www.lens.org/lens/patent/076-262-596-914-468	US 9,458,218 B2	N.A.
6267	059-320-765-410-102	2016	GS(n-octanoyl-S)FLSPEHQKAQQRKESKKPPAKLQPRC	rGhrelin-carrier conjugate	None	Free	cysteine	Linear	L	Vitamin D3-PEG-maleimide	E. coli	Therapeutic	NA	0.1 mg/kg	8	NA	ELISA	Rats	in vivo	https://www.lens.org/lens/patent/059-320-765-410-102	US 9,289,507 B2	N.A.
6280	179-033-965-606-598	2017	None	20K-PEG-insulin	None	20K-PEG	Free	Linear	L	None	Human	NA	15 min	NA	improved	NA	enzyme immunoassay	Rat Blood	in vivo	https://lens.org/179-033-965-606-599	US 9616109 B2	EC50 =26.3ng/ml
6281	179-033-965-606-598	2017	None	VitD-(25)-PEG2K-insulin	None	VitD-(25)-PEG2K	Free	Linear	L	None	Human	NA	2-16 hours	NA	improved	NA	enzyme immunoassay	Rat Blood	in vivo	https://lens.org/179-033-965-606-600	US 9616109 B2	EC50 =15.8ng/ml
6282	179-033-965-606-598	2017	None	VitD-(3)-PEG1.2K-insulin	None	VitD-(3)-PEG1.2K	Free	Linear	L	None	Human	NA	20 min	NA	Drastically Improved	NA	enzyme immunoassay	Rat Blood	in vivo	https://lens.org/179-033-965-606-601	US 9616109 B2	EC50= 282.2ng/ml
6295	034-343-155-162-302	2017	None	singly stapled SAH-Ex(A)	None	SAH	Free	Linear	L	None	NA	NA	NA	NA	94	chymotrypsin	ELISA	NA	in vitro	https://lens.org/034-343-155-162-302	US 9695224 B2	NA
6296	034-343-155-162-302	2017	None	singly stapled SAH-Ex(B)	None	SAH	Free	Linear	L	None	NA	NA	NA	NA	128	chymotrypsin	ELISA	NA	in vitro	https://lens.org/034-343-155-162-302	US 9695224 B2	NA
6297	034-343-155-162-302	2017	None	doubly stapled SAH-Ex(A, B)	None	SAH	Free	Linear	L	None	NA	NA	NA	NA	295	chymotrypsin	ELISA	NA	in vitro	https://lens.org/034-343-155-162-302	US 9695224 B2	NA
6299	034-343-155-162-302	2017	None	singly stapled SAH-Ex(A)	None	Free	SAH	Linear	L	None	NA	NA	NA	NA	81	pepsin	ELISA	NA	in vitro	https://lens.org/034-343-155-162-302	US 9695224 B2	NA
6300	034-343-155-162-302	2017	None	SAH-Ex(A, B)	None	Free	SAH	Linear	L	None	NA	NA	NA	NA	172	pepsin	ELISA	NA	in vitro	https://lens.org/034-343-155-162-302	US 9695224 B2	NA