Peplife 2.0 - Browse by Length

Browsing by Length

Browse Results:

Filter by Year
From
Upto

ID	PMID	YEAR	Sequence	Name	Length	N-ter MOD	C-ter MOD	Linear/Cyclic	Chirality	Chem-MOD	Origin	Nature	Incubation Time	Concentration	Half Life	Protease	Assay	Test Sample	Vivo/Vitro	Reference	Patent No.	Activity
2080	9067297	1996	YGGFLRRl	E-2078 [N-methyl-Tyr1, N-methyl-Arg7-D-Leu8] Dyn A (1 €“8) ethylamide]	N.A.	Methylation	Ethylamide	Linear	Mix	Methylation on Arg7 and Tyr1	Dynorphin A (1 €“ 8) analog	Analgesic	Not reported	10 mg/kg	44	Monkey blood proteases	MALDI-MS	Rhesus monkey blood plasma (Intravenous)	in vivo	7479294	None	Not available
4019	38737283	2024	LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP-FRRG-(E5C3)-(GN)	ABD035-immunoGN	N.A.	P1h3	His-tag	Linear	L	Humanized anti-HER2 scFv P1h3, albumin-binding peptides (ABD035 or dAb7h8), cathepsin B-cleavable peptide B2, endosome-disruptive peptide E5C3 fusion protein, GN= Gasdermin-N	Synthetic	Antitumor	Blood samples were promptly collected at 5, 10, 30, 60, 360, and 720 min	0.1 μmol/kg	35.22	BALB/c mice serum protease	ELISA	BALB/c mice serum	In Vivo	None	None	Cytotoxicity of ABD035-immunoGN in N87 cells reached as high as 62 %, compared to 38 % for immunotBid after 24 h of incubation
4020	38737283	2024	FRRG-(E5C3)-(GN)	immunoGN	N.A.	P1h3	His-tag	Linear	L	Humanized anti-HER2 scFv P1h3, albumin-binding peptides (ABD035 or dAb7h8), cathepsin B-cleavable peptide B2, endosome-disruptive peptide E5C3 fusion protein, GN= Gasdermin-N	Synthetic	Antitumor	Blood samples were promptly collected at 5, 10, 30, 60, 360, and 720 min	0.1 μmol/kg	4.599	BALB/c mice serum protease	ELISA	BALB/c mice serum	In Vivo	None	None	Cytotoxicity of ABD035-immunoGN in N87 cells reached as high as 62 %, compared to 38 % for immunotBid after 24 h of incubation
4021	38737283	2024	DIQMTQSPSSLSAVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYRNSPLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTYRVPPTFGQGTKVEIKR-FRRG-(E5C3)-(GN)	dAb7h8-immunoGN	N.A.	P1h3	His-tag	Linear	L	Humanized anti-HER2 scFv P1h3, albumin-binding peptides (ABD035 or dAb7h8), cathepsin B-cleavable peptide B2, endosome-disruptive peptide E5C3 fusion protein, GN= Gasdermin-N	Synthetic	Antitumor	Blood samples were promptly collected at 5, 10, 30, 60, 360, and 720 min	0.1 μmol/kg	31.25	BALB/c mice serum protease	ELISA	BALB/c mice serum	In Vivo	None	None	Cytotoxicity of ABD035-immunoGN in N87 cells reached as high as 62 %, compared to 38 % for immunotBid after 24 h of incubation
4048	38399408	2024	N.A.	BI-X	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment Of Human Ocular Disease	serial blood samples were taken in EDTA anticoagulant pre-dose and at 1 h, 2 h, 4 h, 24 h, 48 h, 72 h, 96 h, and 168 h and 2, 4, 6, 8, and 10 weeks after dosing or until the last in-life timepoint of the animals.	0.25 mg/eye	3	Cynomolgus Monkeys Plasma Protease	Immunocapture-LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	Affinity binding site to human albumin (KD = 1.4 nM)
4049	38399408	2024	N.A.	BI-X	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment Of Human Ocular Disease	serial blood samples were taken in EDTA anticoagulant pre-dose and at 1 h, 2 h, 4 h, 24 h, 48 h, 72 h, 96 h, and 168 h and 2, 4, 6, 8, and 10 weeks after dosing or until the last in-life timepoint of the animals.	0.25 mg/eye	13.2	Cynomolgus Monkeys Plasma Protease	Immunocapture-LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	Affinity binding site to human albumin (KD = 1.4 nM)
4050	38399408	2024	N.A.	BI-X	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment Of Human Ocular Disease	serial blood samples were taken in EDTA anticoagulant pre-dose and at 1 h, 2 h, 4 h, 24 h, 48 h, 72 h, 96 h, and 168 h and 2, 4, 6, 8, and 10 weeks after dosing or until the last in-life timepoint of the animals.	0.25 mg/eye	11.8	Cynomolgus Monkeys Plasma Protease	Immunocapture-LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	Affinity binding site to human albumin (KD = 1.4 nM)
4118	38863646	2024	N.A.	(89Zr, Mn)-WPMNs	N.A.	Free	Free	Linear	L	Mn and 89Zr labeling, MNPs modified with WL12-SH	WL12 derivative	Targets PD-L1	Blood samples were collected from orbital vein at 1, 3, 5, 10, 15, 20, 30, 45 min and 1, 1.5, 2, 3, 4, 14, 24, 48, 72, 96 h	0.5 mg/ml	0.1234 (Fast) (Metabolic Half Life)	KM mouse blood protease	Radioactivity assay using γ-counter	KM mouse blood	In Vivo	None	None	N.A.
4119	38863646	2024	N.A.	(89Zr, Mn)-WPMNs	N.A.	Free	Free	Linear	L	Mn and 89Zr labeling, MNPs modified with WL12-SH	WL12 derivative	Targets PD-L1	Blood samples were collected from orbital vein at 1, 3, 5, 10, 15, 20, 30, 45 min and 1, 1.5, 2, 3, 4, 14, 24, 48, 72, 96 h	0.5 mg/ml	1.554 (Slow) (Distribution Half Life)	KM mouse blood protease	Radioactivity assay using γ-counter	KM mouse blood sample	In Vivo	None	None	N.A.
4120	38697423	2024	N.A.	DAE Rum55	N.A.	N.A.	N.A.	N.A.	D	N.A.	Ruminococcus sp. CAG55	Epimerase	50 °C	N.A.	4.5 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	D-allulose/D-psicose 3-epimerase (DAE/DPE, EC 5.1.3.30) and D-tagatose 3-epimerase (DTE, EC 5.1.3.31), of which DAE usually exhibits higher catalytic activity
4121	38697423	2024	N.A.	E268R-EKL16	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Ruminococcus sp. CAG55 derivative	Epimerase	50 °C	N.A.	135.3 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	D-allulose/D-psicose 3-epimerase (DAE/DPE, EC 5.1.3.30) and D-tagatose 3-epimerase (DTE, EC 5.1.3.31), of which DAE usually exhibits higher catalytic activity
4122	38753095	2024	N.A.	Xyn10-HB	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	GH10 xylanase from Halalkalibacterium halodurans C-125	GH10 xylanase	pH 8.5 and 60 °C	N.A.	3 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	Xyn10-HB produced active XOS with antioxidant activity determined by the DPPH radical scavenging method (IC50 of 0.54 mg/mL after 4 h)
4123	38115231	2024	N.A.	Trx1P	N.A.	N.A.	N.A.	Linear	L	N.A.	Derived from E. coli thioredoxin (Trx).	N.A.	N.A.	N.A.	124 ± 15 (T1/2 Cis-Trans Isomerizations)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4124	38115231	2024	N.A.	Trx1Thp	N.A.	N.A.	N.A.	Linear	L	Incorporation of 4-thiaproline (Thp) at position cisPro76	Derived from E. coli thioredoxin (Trx).	N.A.	N.A.	N.A.	33 ± 3 (T1/2 Cis-Trans Isomerizations)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4178	37875481	2023	N.A.	IL-15-Cy7	N.A.	Free	Free	Linear	L	Cy7	Derived from Interleukin-15	Antitumor	The blood sample was harvested at timed intervals (2 min, 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, 12 h, and 24 h)	N.A.	0.69	Mice blood protease	Fluorescence spectrophotometry	Mice blood	In Vivo	None	None	Not mentioned
4179	37875481	2023	N.A.	biNV-IL-15-Cy7	N.A.	Free	Free	Linear	L	Cy7	Derived from Interleukin-15	Antitumor	The blood sample was harvested at timed intervals (2 min, 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, 12 h, and 24 h)	N.A.	5.66	Mice blood protease	Fluorescence spectrophotometry	Mice blood	In Vivo	None	None	Not mentioned
4388	37329900	2023	N.A.	KAN-101	N.A.	N.A.	N.A.	N.A.	N.A.	Liver-targeting glycosylation signature conjugated to a deaminated gliadin peptide	N.A.	Liver-Targeted Immune Tolerance Therapy	N.A.	0·15 mg/kg, 0·3 mg/kg, 0·6 mg/kg, 1·2 mg/kg, 1·5 mg/kg	3·72 to 31·72	Human protease	N.A.	Human	In Vivo	None	None	N.A.
4520	36075899	2022	N.A.	S-20-1	N.A.	N.A.	N.A.	Cyclic	L	Modified by adding negative charge	Synthetic	Antiviral (Against Infection By Sars-Cov-2 )	Blood samples were collected at 10 min, 20 min, 30 min, 1 h, 2 h, 4 h, 8 h, 24 h and 48 h	50 mg/kg	14.53 (Terminal Elimination Half Life)	C57Bl/6 mice plasma protease	LC-MS/MS	C57BL/6 mice plasma	In Vivo	None	None	IC50 (μM) = 0.8 in HUH 7 cells
4521	36075899	2022	N.A.	S-20-1	N.A.	N.A.	N.A.	Cyclic	L	Modified by adding negative charge	Synthetic	Antiviral (Against Infection By Sars-Cov-2 )	Blood samples were collected at 10 min, 20 min, 30 min, 1 h, 2 h, 4 h, 8 h, 24 h and 48 h	50 mg/kg	24.29 (Terminal Elimination Half Life)	C57Bl/6 mice plasma protease	LC-MS/MS	C57BL/6 mice plasma	In Vivo	None	None	IC50 (μM) = 0.8 in HUH 7 cells
4719	N.A.	2022	N.A.	Test 1	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	100 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4720	N.A.	2022	N.A.	Test 2	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	101 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4721	N.A.	2022	N.A.	Test 3	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	105 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4722	N.A.	2022	N.A.	Test 4	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	GLP-1 analogs	Antidiabetes	Blood samples (0.8 Ml) were taken via the second catheter at predetermined time points (0-3 weeks)	10 nmol/kg	109 (Terminal Half Life)	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vivo	None	EP 2021080747 W	N.A.
4755	35910276	2022	N.A.	BA17	N.A.	Free	Free	Linear	L	None	Isolated from B. licheniformis	Serine protease	50°C	N.A.	90 (Enzyme Activity)	N.A.	Zymography	N.A.	In Vitro	None	None	N.A.
4756	35910276	2022	N.A.	BA17	N.A.	Free	Free	Linear	L	None	Isolated from B. licheniformis	Serine protease	60 °C	N.A.	12 (Enzyme Activity)	N.A.	Zymography	N.A.	In Vitro	None	None	N.A.
4763	35488338	2022	N.A.	FRAP-smTG	N.A.	Frap (A Fusion Tag)	Free	Linear	L	None	TGm1 variant	Used to generate protein crosslinking or attachment of small molecules	60 ℃	0.4 mg/mL	< 2 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4764	35488338	2022	N.A.	FRAP-TGm1	N.A.	Frap (A Fusion Tag)	Free	Linear	L	None	TGm1 variant	Used to generate protein crosslinking or attachment of small molecules	60 ℃	0.4 mg/mL	11.31 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4765	35488338	2022	N.A.	FRAPD-TGm1	N.A.	Frap (A Fusion Tag)	Free	Linear	L	additional modification (Asp residue)	TGm1 variant	Used to generate protein crosslinking or attachment of small molecules	60 ℃	0.4 mg/mL	21.97 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	N.A.
4770	35133860	2022	N.A.	E187A	N.A.	Free	Free	Linear	L	Residue Glu187 of the Ca1 site in the catalytic domain was replaced by Ala	Derived from preTSS	Collagenolytic protease	70°C	N.A.	N.A.	N.A.	N.A.	N.A.	In Viro Study	None	None	When the residue Glu187 of the Ca1 site in the catalytic domain was replaced by Ala, the resulting variant E187A was completely inactivated after incubation at 70°C for 3 h
5229	32034289	2020	VL-GGGGSGGGGSGGGGS-VH-GGGGS-KPLPEVTDEY	α-GD2 scFv TM	N.A.	Radiolabelled with 64Cu	E5B9	Linear	L	VH and VL joined by linker (GGGGS)3	Synthetic	Antitumor	N.A.	N.A.	1.6	Mice blood protease	PET scanning	Mice blood sample	In Vivo	E5B9 sequence available on this link: https://pmc.ncbi.nlm.nih.gov/articles/PMC6805801/	None	EC50 = 0.7 nM (target cell lysis)
5282	32454120	2020	N.A.	Uox-WT	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	1.1 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5283	32454120	2020	N.A.	Uox-HSA	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	17.4 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5284	32454120	2020	N.A.	PEG-PAEU + Uox-HSA	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	43.6 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5285	32454120	2020	N.A.	PEG-PAEU-ABP + Uox-HSA	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Treatment of hyperuricemia	Incubated for 4 h at room temperature	28 μM	96.3 (Enzymatic Activity Half Life)	Mice serum protease	Uric acid degradation assay	Mice serum	In Vivo	None	None	N.A.
5337	31453257	2019	N.A.	Pept. A	N.A.	Free	Free	Cyclic	L	N.A.	N.A.	Therapeutic agent against a CNS-related disorder	Blood (100 µl) and CSF (100 µl) aliquots for drug concentration assessment were collected pre-dose, on study day 1 at 0.5, 1.5, 3, 6, and 24 h post first dose, and on study day 2 at 1.5 h post the second dose (corresponding to 25.5 h from study start)	4.2 mg/kg	3.5 ± 0.7 (Terminal Half Life)	Göttingen minipigs plasma protease	LC-MS/MS	Göttingen minipigs plasma	In Vivo	None	None	N.A.
5338	31453257	2019	N.A.	Pept. A	N.A.	Free	Free	Cyclic	L	N.A.	N.A.	Therapeutic agent against a CNS-related disorder	Blood (100 µl) and CSF (100 µl) aliquots for drug concentration assessment were collected pre-dose, on study day 1 at 0.5, 1.5, 3, 6, and 24 h post first dose, and on study day 2 at 1.5 h post the second dose (corresponding to 25.5 h from study start)	4.2 mg/kg	14.3 ± 5.5 (Terminal Half Life)	göttingen Minipig Csf Lumbar Protease	LC-MS/MS	Göttingen minipigs CSF lumbar	In Vivo	None	None	N.A.
5601	30344018	2019	N.A.	ASN	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	B. cereus BDRD-ST26 (P43-amyE-BcA)	Production of acrylamide-free food	50 C	N.A.	17.35 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	Km = 9.38 mM
5602	30344018	2019	N.A.	ASN	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	B. cereus BDRD-ST26 (P43-BcA)	Production of acrylamide-free food	50 C	N.A.	17.57 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	km = 9.41 mM
5603	30344018	2019	N.A.	ASN	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	B. subtilis 168	Production of acrylamide-free food	65 C	N.A.	61 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	km = 5.3 mM
5604	30344018	2019	N.A.	ASN	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	T. kodakaraensis 1656	Production of acrylamide-free food	85 C	N.A.	130 (Activity Half Life)	N.A.	N.A.	N.A.	N.A.	None	None	km = 5.5 mM
5631	30809901	2019	N.A.	FITC-AAR029b	N.A.	Fluorescein isothiocynate labeled	Free	Macrocyclic	L	None	Derived from a class of peptides known as cyclic peptide triazoles (cPTs)	Antiviral	N.A.	0.01 mg/kg	0.029 ± 0.01 (T1/2Α-Distribution Half Life)	Rats plasma protease	Fluorescence assay	Rats plasma	In Vivo	None	None	EC50(nM) = 210±16 for AAR029b in Bal.01 virus
5632	30809901	2019	N.A.	FITC-AAR029b in Liposome	N.A.	Fluorescein isothiocynate labeled	Free	Macrocyclic	L	None	Derived from a class of peptides known as cyclic peptide triazoles (cPTs)	Antiviral	N.A.	0.01 mg/kg	0.032 ± 0.005 (T1/2Α-Distribution Half Life)	Rats plasma protease	Fluorescence assay	Rats plasma	In Vivo	None	None	EC50(nM) = 210±16 for AAR029b in Bal.01 virus
5875	29335522	2018	N.A.	PAK2	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Role in PDAC cancer invasion and metastasis	N.A.	N.A.	4.5	Miapaca-2 cell lysate protease	Western blotting	Miapaca-2 cells lysate after PKM2 depletion (treated with 20 μg/ml cycloheximide (CHX))	In Vitro	None	None	N.A.
5876	29335522	2018	N.A.	PAK2	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Synthetic	Role in PDAC cancer invasion and metastasis	N.A.	N.A.	>24	Miapaca-2 cell lysate protease	Western blotting	Miapaca-2 cells lysate with PKM2 expression (treated with 20 μg/ml cycloheximide (CHX))	In Vitro	None	None	N.A.
5885	29282303	2018	SIINFEKL	SCRAP-mCherry	N.A.	DD	mCherry	N.A.	L	None	Synthetic	Affects Antigen Presentation	N.A.	N.A.	41 ± 5	El4 cells protease	BD cytoflex flow cytometry	EL4 cells after Shield-1 removal	N.A.	None	None	N.A.
5916	29633613	2018	N.A.	ThXylC	N.A.	Free	Free	Linear	L	None	Obtained from the soluble fractions of the recombinant E. coli BL21(DE3) cells	β-xylosidase	65 °C	N.A.	8.9 (Activity Half Life)	N.A.	N.A.	ThXylC	In Vitro	None	None	N.A.
5917	29633613	2018	N.A.	ThXylC-ELK	N.A.	Free	ELK16 short peptide was introduced to the C-terminus of ThXylC	Linear	L	None	Obtained from the soluble fractions of the recombinant E. coli BL21(DE3) cells	β-xylosidase	65 °C	N.A.	54.8 (Activity Half Life)	N.A.	N.A.	ThXylC-ELK	In Vitro	None	None	N.A.
5922	29373818	2018	N.A.	fibrinolytic enzyme	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	From the marine Serratia marcescens subsp sakuensis	Clot lysis	37 °C	N.A.	19 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	N.A.
5923	29373818	2018	N.A.	fibrinolytic enzyme	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	From the marine Serratia marcescens subsp sakuensis	Clot lysis	50°C	N.A.	29 (Activity Half Life)	N.A.	N.A.	N.A.	In Vitro	None	None	N.A.
5979	28714475	2017	EYEK(C14)EYE-(PEG24)3-XCFRLPCRQLRC	tag-3xPEG24-FXIIa inhibitor	N.A.	Tag-3xPEG24	Amidation	Bi-Cyclic(C2-7, C7-C12 Disulfide Bond In Fxiia Inhibitor)	L	None	Synthetic	FXIIa Inhibitor	N.A.	5 mg/kg	1.0 ± 0.2 (T1/2a)	Rabbit plasma protease	RP-HPLC using fluorescence detector	Rabbit plasma	In Vivo	None	None	(EC5x) at 4.2±0.5 mM
5980	28714475	2017	EYEK(C14)EYE-(PEG24)3-XCFRLPCRQLRC	tag-3xPEG24-FXIIa inhibitor	N.A.	Tag-3xPEG24	Amidation	Bi-Cyclic(C2-7, C7-C12 Disulfide Bond In Fxiia Inhibitor)	L	None	Synthetic	FXIIa Inhibitor	N.A.	5 mg/kg	5.2 ± 0.4 (T1/2b)	Rabbit plasma protease	RP-HPLC using fluorescence detector	Rabbit plasma	In Vivo	None	None	(EC5x) at 4.2±0.5 mM
5981	28714475	2017	XCFRLPCRQLRC	FXIIa inhibitor	N.A.	Fluorescein (F)	Amidation	Bi-Cyclic(C2-7, C7-C12 Disulfide Bond In Fxiia Inhibitor)	L	None	Synthetic	FXIIa Inhibitor	N.A.	3.7 mg/kg	0.21 ± 0.04 (T1/2b)	Rabbit plasma protease	A single quadrupole liquid chromatography mass spectrometer	Rabbit plasma	In Vivo	None	None	Ki FXIIa = 4±0.9 nM in presence of albumin
6047	28068664	2017	N.A.	scFv57R	N.A.	Free	Free	Linear	L	None	Synthetic	Antiviral (against Rabies Virus)	37o C for 0-72 hours	0.5 mg/ml	14.1	N.A.	ELISA	PBS	In Vitro	None	None	Neutralizing potency (IU/ml) = 83.8 ± 9.4 for monomer
6048	28068664	2017	DPDNEAYEMPSEEGYQDYEPEA	scFv57R-ATS	N.A.	Free	(ATS) was fused to the C-terminus of the anti-RV scFv57R	Linear	L	None	scFv57R-ATS fusion protein	Antiviral (against Rabies Virus)	37o C for 0-72 hours	0.5 mg/ml	33.9	N.A.	ELISA	PBS	In Vitro	None	None	Neutralizing potency (IU/ml) = 2.9 ± 0.5 for polymer
6049	28068664	2017	DPDNEAYEMPSEEGYQDYEPEA	scFv57R-ATS	N.A.	Free	(ATS) was fused to the C-terminus of the anti-RV scFv57R	Linear	L	None	scFv57R-ATS fusion protein	Antiviral (against Rabies Virus)	37o C	0.5 mg/ml	15.6	Mouse serum protease	ELISA	Mouse serum	In Vitro	None	None	Neutralizing potency (IU/ml) = 2.9 ± 0.5 for polymer
6078	27689406	2017	N.A.	X1	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Antiobesity	N.A.	N.A.	3.9	Surgical rats plasma protease (Wistar Rat)	RIA	Surgical rats plasma (Wistar rat)	In Vivo	None	None	N.A.
6079	27689406	2017	N.A.	X2	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Antiobesity	N.A.	N.A.	16.1	Surgical rats plasma protease (Wistar Rat)	RIA	Surgical rats plasma (Wistar rat)	In Vivo	None	None	N.A.
6080	27689406	2017	N.A.	X3	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	N.A.	Antiobesity	N.A.	N.A.	21.3	Surgical rats plasma protease (Wistar Rat)	RIA	Surgical rats plasma (Wistar rat)	In Vivo	None	None	N.A.