Please wait...
| ID | PMID | YEAR | Sequence | Name | Length | N-ter MOD | C-ter MOD | Linear/Cyclic | Chirality | Chem-MOD | Origin | Nature | Incubation Time | Concentration | Half Life | Units Half Life | half-life(in Sec) | Protease | Assay | Test Sample | Vivo/Vitro | Reference | Patent No. | Activity |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 20844765 | 2010 | Lfc4 | 6 | Acetylation | Amidation | Linear | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~90 | minutes | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=15μM for E.coli | ||
| 20844765 | 2010 | Lfc4 | 6 | Acetylation | Amidation | Linear | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~90 | minutes | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=60μM for S. aureus | ||
| 20844765 | 2010 | Lfc4 | 6 | Acetylation | Amidation | Linear | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~90 | minutes | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=3.8μM for B. subtilis | ||
| 20844765 | 2010 | Com4 | 6 | Acetylation | Amidation | Linear | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~90 | minutes | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=7.5μM for E.coli | ||
| 20844765 | 2010 | Com4 | 6 | Acetylation | Amidation | Linear | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~90 | minutes | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=7.5μM for S. aureus | ||
| 20844765 | 2010 | Com4 | 6 | Acetylation | Amidation | Linear | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~90 | minutes | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=1.9 μM for B. subtilis | ||
| 20844765 | 2010 | Lfc6 | 8 | Free | Amidation | Cyclic (C1-C8) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~1.5 | hours | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=15μM for E.coli | ||
| 20844765 | 2010 | Lfc6 | 8 | Free | Amidation | Cyclic (C1-C8) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~1.5 | hours | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=3.8μM for S. aureus | ||
| 20844765 | 2010 | Lfc6 | 8 | Free | Amidation | Cyclic (C1-C8) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | ~1.5 | hours | 5400 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=0.9μM for B. subtilis | ||
| 20844765 | 2010 | Lfc8 | 11 | Free | Free | Cyclic (head-to-tail backbone cyclization) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | 110 | minutes | 6600 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=3.8 μM for E.coli | ||
| 20844765 | 2010 | Lfc8 | 11 | Free | Free | Cyclic (head-to-tail backbone cyclization) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | 110 | minutes | 6600 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=15μM for S. Aureus | ||
| 20844765 | 2010 | Lfc8 | 11 | Free | Free | Cyclic (head-to-tail backbone cyclization) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | 110 | minutes | 6600 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99 ‰¤ 0.45μM for B. subtilis | ||
| 20844765 | 2010 | Lfc9 | 13 | Free | Amidation | Cyclic (C1-C13) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | 110 | minutes | 6600 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99=1.9 μM for E.coli | ||
| 20844765 | 2010 | Lfc9 | 13 | Free | Amidation | Cyclic (C1-C13) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | 110 | minutes | 6600 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99 ‰¤ 0.45μM for S. Aureus | ||
| 20844765 | 2010 | Lfc9 | 13 | Free | Amidation | Cyclic (C1-C13) | L | None | Synthetic | Antimicrobial | 9 hours | 5 µM | 110 | minutes | 6600 | Human serum proteases | RP-HPLC | Human serum | in vitro | None | None | LD99.99 ‰¤ 0.45μM for B. subtilis | ||
| 12699744 | 2003 | Peptide 5a | 18 | Acetylation [(C6H6)-(C6H12)-(C6H6)] | Amidation | Linear | L | None | Synthetic | Anticoagulant | Not reported | 2mg/kg | 222 | minutes | 13320 | Rabbit blood proteases | ELISA | Intravenouly administered into rabbit blood | in vivo | None | None | IC50=90nM for fVIIa binding assay in presence 0f 0.1% rabbit serum albumin | ||
| 12699744 | 2003 | Peptide 5c | 18 | Acetylation [(C6H6)(CH2)4CH3] | Amidation | Linear | L | None | Synthetic | Anticoagulant | Not reported | 2mg/kg | 79.1 | minutes | 4746 | Rabbit blood proteases | ELISA | Intravenouly administered into rabbit blood | in vivo | None | None | IC50=22nM for fVIIa binding assay in presence 0f 0.1% rabbit serum albumin | ||
| 2147696 | 1990 | Synthetic peptide | 10 | Free | Free | Linear | L | None | Synthetic peptide (corresponding to amino acids 605-614 of human protein S) | Anticoagulant | Not reported | Not mentioned | 80 | minutes | 4800 | Rabbit blood proteases | Spectrofluorometry | Intravenously injected in male New Zealand white rabbits and blood samples withdrawn and plasma sample prepared | in vivo | None | None | 34% of 125I protein S bound to C4b-binding protein in presence of 150 µM of peptide | ||
| 11099487 | 2000 | Int-H1-S6A,F8A | 30 | Free | Free | Linear | L | None | C-Myc derivative | Antiproliferative and proapoptotic | Not reported | Not mentioned | 4.62 | hours | 16632 | Fetal calf serum proteases | HPLC | Fetal bovine serum batch3 | in vitro | None | None | Not reported | ||
| 12578830 | 2003 | iAβ5p-A4 | 5 | Acetylation | Amidation | Linear | L | NMe | Synthetic | β-sheet breaker peptides | Not reported | 20 nmol | 5 | hours | 18000 | Proteases in rat brain homogenate | RP-HPLC | Rat brain homogenate | in vitro | None | None | >80% inhibition of amyloid fibrillogenesis | ||
| 15487959 | 2004 | Melagatran | 1 | N.A. | N.A. | Linear | L | N.A. | Synthetic | Anticoagulant | Not reported | 10-10 €“10-5 M | 4 | hours | 14400 | Human plasma protease | Not mentioned | Human plasma | in vivo | None | None | Not reported | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=3 µg/ml for M. Luteus ATCC 9341 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=12.5 µg/ml for M. Luteus ATCC 9342 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=3.12 µg/ml for M. Luteus ATCC 9344 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=10 µg/ml for S. Aureus ATCC 6540 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=25 µg/ml for S. Aureus ATCC 6541 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=9 µg/ml for S. Aureus ATCC 6543 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=1.56 µg/ml for S. Epidemidis ATCC 12229 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=3.12 µg/ml for S. Epidemidis ATCC 12228 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=2 µg/ml for S. Epidemidis ATCC 12228 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=50 µg/ml for MRSA SR 1553 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=>100 µg/ml for MRSA SR 1554 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=38 µg/ml for MRSA SR 1556 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=25 µg/ml for M. smegmatis ATCC 607 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=25 µg/ml for M. smegmatis ATCC 607 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=12.5 µg/ml for M. smegmatis ATCC 613 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=12.5 µg/ml for E. coli ATCC 2592 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=31 µg/ml for E. coli ATCC 2592 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=19 µg/ml for E. coli ATCC 2592 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=6.25 µg/ml for P. aeruginosa ATCC 9027 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=25 µg/ml for P. aeruginosa ATCC 9027 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=6.25 µg/ml for P. aeruginosa ATCC 9027 | ||
| 10461747 | 1998 | KSL3 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=6.25 µg/ml for C. albicans ATCC 36232 | ||
| 10461747 | 1998 | KSL4 | 10 | Free | Free | Linear | Mix | Reduced amide bonds Ψ(CH2NH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | >81 | minutes | 4860 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=31 µg/ml for C. albicans ATCC 36232 | ||
| 10461747 | 1998 | KSL6 | 10 | Free | Free | Linear | Mix | Reduced carbamate Ψ(CH2OCONH) | Synthetic | Antimicrobial | Not reported | 100 µg/mL | 67 | minutes | 4020 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC=11 µg/ml for C. albicans ATCC 36232 | ||
| 14759771 | 2004 | Glucagon-like peptide-1(7-36)amide | 30 | Free | Amidation | Linear | L | None | Glucagon-like peptide-1 | Regulate blood glucose | 12 hours | 2 mM | 4.4 | hours | 15840 | Purified DPP IV | ESI-MS | Purified DPP IV | in vitro | None | None | 0 ±0% insulin intensity in ARIP cells | ||
| 14759771 | 2004 | Glucagon-like peptide-1(7-36)amide | 30 | Free | Amidation | Linear | L | None | Glucagon-like peptide-1 | Regulate blood glucose | 12 hours | 2 mM | 4.7 | hours | 16920 | Serum proteases | ESI-MS | Serum | in vitro | None | None | 0 ±0% glucokinase intensity in ARIP cells | ||
| 14980787 | 2004 | Alanyl-aspartate | 2 | Free | Free | Linear | L | None | Synthetic | Angiotensin Coverting Enzyme inhibitor | Not mentioned | Not mentioned | 64 | minutes | 3840 | Rat plasma proteases | Spectrophotometry | Rat plasma | in vitro | None | None | IC50=>1600 µM | ||
| 21244372 | 2010 | Exenatide | 39 | Free | Amidation | Linear | L | None | Synthetic version of the 39-amino-acid peptide originally isolated from the saliva of the gila monster lizard | Regulate blood glucose | Not mentioned | 5 µg ·mL-1 ·kg-1 | 1.5 to 4 | hours | 9900 | Rat plasma proteases | ELISA | Intravenously injected into Sprague-Dawley rats at a dose of 5 µg ·mL-1 ·kg-1 | in vivo | None | None | EC50 of 2.3nM for stimulation of intracellular cAMP in PC12 cells | ||
| 21244372 | 2010 | PB-105 (ExC39) | 39 | Free | Amidation | Linear | L | None | Analogue of exenatide | Regulate blood glucose | Not mentioned | 5 µg ·mL-1 ·kg-1 | 2.9 ±0.1 | hours | 10440 | Rat plasma proteases | ELISA | Intravenously injected into Sprague-Dawley rats at a dose of 5 µg ·mL-1 ·kg-1 | in vivo | None | None | EC50 of 1.4nM for stimulation of intracellular cAMP in PC12 cells | ||
| 21114599 | 2010 | [Aib35]hGLP-1(7-36)NH2 | 30 | Free | Amidation | Linear | L | Aib--Aminoisobutyric acid | Analogue of glucagon like peptide-1 | Regulate blood glucose | Not mentioned | Not mentioned | 2.0 ±0.3 | hours | 7200 | Rat plasma proteases | HPLC | Rat plasma | in vitro | 14759771 | None | EC50=0.05 ±0.01nM for cAMP stimulation | ||
| 20587645 | 2010 | mPEG-ALD10k-HM-3 | 16 | Methoxy-polyethylene glycolPEG-aldehyde (mPEG-ALD10k ) | Free | Linear | L | None | HM-3 analogue | Anti-angiogenetic | Not mentioned | Not mentioned | 162.08 ±36.57 | minutes | 9724.8 | Proteases in chorioallantoic membrane of chick embryo | RP-HPLC | Chorioallantoic membrane of chick embryo | in vivo | http://pubs.rsc.org/En/content/articlepdf/2014/tb/ | None | Dramatically inhibits angiogenesis on the chorioallantoic membrane of chick embryo | ||
| 20593470 | 2010 | Peptide 2 | 41 | Free | Amidation | Linear | L | None | Synthetic dipeptide extended GLP-analogs | Regulate blood glucose | 168 hours | Not mentioned | 1.1 | hours | 3960 | None | HPLC | PBS | in vitro | None | None | Not reported | ||
| 20593470 | 2010 | Peptide 5 | 41 | Free | Amidation | Linear | L | None | Synthetic dipeptide extended GLP-analogs | Regulate blood glucose | 168 hours | Not mentioned | 4.7 | hours | 16920 | None | HPLC | PBS | in vitro | None | None | Not reported | ||
| 20593470 | 2010 | Peptide 11 | 41 | Free | Amidation | Linear | L | None | Synthetic dipeptide extended GLP-analogs | Regulate blood glucose | 168 hours | Not mentioned | 2.5 | hours | 9000 | None | HPLC | PBS | in vitro | None | None | EC50=0.23 ±0.10nM | ||
| 20593470 | 2010 | Peptide 12 | 41 | Free | Amidation | Linear | L | None | Synthetic dipeptide extended GLP-analogs | Regulate blood glucose | 168 hours | Not mentioned | 2.8 | hours | 10080 | None | HPLC | PBS | in vitro | None | None | Not reported | ||
| 20593470 | 2010 | Peptide 13 | 41 | Free | Amidation | Linear | L | None | Synthetic dipeptide extended GLP-analogs | Regulate blood glucose | 168 hours | Not mentioned | 2.4 | hours | 8640 | None | HPLC | PBS | in vitro | None | None | Not reported | ||
| 20560643 | 2009 | Peptide 1 (TY027) | 8 | Free | NH-3,5-Bzl(CF3)2 | Linear | Mix | None | Synthetic | Opioid receptor agonist | 24 hours | Not mentioned | 4.8 | hours | 17280 | Rat plasma proteases | HPLC | Rat plasma | in vitro | None | None | IC50=15 ±2nM for MVD | ||
| 20631047 | 2010 | Xenin | 25 | Free | Free | Linear | L | None | Secreted from intestinal K-cells | Regulates insulin | 360 minutes | Not mentioned | 162 ±6 | minutes | 9720 | Mice plasma proteases | HPLC | Mice plasma | in vitro | 1429581 | None | Stimulated insulin secretion at 5.6 mM In clonal BRIN-BD11 cells | ||
| 12047915 | 2002 | LY315902 | 35 | 2-indolyl-propionyl | Free | Linear | L | Oct-octanoic moiety | Glucagon-like peptide-1 analogue | Insulinotropic and glucagonostatic | Not mentioned | Not mentioned | 1.1 | hours | 3960 | Canine plasma protease | Radioimmunoassay | Canine plasma after subcutaneous injection of 100 µg/kg | in vivo | 9232514 | None | Plasma insulin 255 pmol/l on intravenous infusion of 20 pmol/kg/min of LY315902 | ||
| 17292977 | 2007 | AC3174 | 39 | Free | Amidation | Linear | L | None | Analog of exendin-4 | Regulates blood glucose | 5 hours | Not mentioned | >5 | hours | 18000 | Human plasma proteases | LC/MS | Human plasma | in vitro | None | None | IC50=0.66 ±0.13nM for binding to GLP-1 receptor | ||
| 14499707 | 2003 | GRF-1PEG5000 | 29 | Free | Amidation | Linear | L | PEGylation | Growth hormone-releasing hormone (GRF) analogue | Stimulates release of growth hormone | 25 hours | Not mentioned | 3.6 | hours | 12960 | Human plasma proteases | Reporter gene assay | Human plasma | in vitro | None | None | EC50=1.06nM | ||
| 14499707 | 2003 | GRF-1PEGLys21 | 29 | Free | Amidation | Linear | L | PEGylation on Lys21 | Growth hormone-releasing hormone (GRF) analogue | Stimulates release of growth hormone | 26 hours | Not mentioned | 4 | hours | 14400 | Human plasma proteases | Reporter gene assay | Human plasma | in vitro | None | None | Not reported | ||
| 2533571 | 1989 | Des-enkephalin-γ-endorphin | 12 | Free | Free | Linear | L | None | Endorphin derivative | Neuropeptide | Not reported | 0.1mM | 4.5 | hours | 16200 | Proteases in SVK14 keratinocytes | HPLC/liquid scintillation counting | SVK14 keratinocytes | in vitro | 3582424 | None | Not reported | ||
| 2533571 | 1989 | Des-enkephalin-γ-endorphin | 12 | Free | Free | Linear | L | None | Endorphin derivative | Neuropeptide | Not reported | 0.1mM | 4.1 | hours | 14760 | Proteases in fibroblasts | HPLC/liquid scintillation counting | Human fibroblasts | in vitro | 3582424 | None | Not reported | ||
| 2533571 | 1989 | Des-enkephalin-γ-endorphin | 12 | Free | Free | Linear | L | None | Endorphin derivative | Neuropeptide | Not reported | 0.1mM | 4.4 | hours | 15840 | Proteases in human fresh whole skin | HPLC/liquid scintillation counting | Human fresh whole skin | in vitro | 3582424 | None | Not reported | ||
| 2533571 | 1989 | Des-enkephalin-γ-endorphin | 12 | Free | Free | Linear | L | None | Endorphin derivative | Neuropeptide | Not reported | 0.1mM | 4.6 | hours | 16560 | Proteases in human fresh epidermis | HPLC/liquid scintillation counting | Human fresh epidermis | in vitro | 3582424 | None | Not reported | ||
| 2533571 | 1989 | Des-enkephalin-γ-endorphin | 12 | Free | Free | Linear | L | None | Endorphin derivative | Neuropeptide | Not reported | 0.1mM | 4.5 | hours | 16200 | Proteases in human fresh dermis | HPLC/liquid scintillation counting | Human fresh dermis | in vitro | 3582424 | None | Not reported | ||
| 3080478 | 1985 | C0-LAP | 15 | Free | Free | Linear | L | None | Lipid associated peptide -20 | Not mentioned | Not reported | 300 µl | ~300 | minutes | 18000 | Not mentioned | Serum decay experiment | Blood sample of female Sprague-Dawley rat | in vivo | 6774331 | None | Not mentioned | ||
| 8222093 | 1993 | Recombinant hirudin | 65 | Free | Free | Linear | L | None | Not available | Anticoagulant | Not reported | 1000ng/ml | 2 to 3 | hours | 9000 | Not mentioned | ELISA | Human blood sample | in vivo | None | None | Not mentioned | ||
| 8257427 | 1993 | AcSDKP | 4 | Acetylation | Free | Linear | L | None | Human bone marrow | Negative regulator of proliferation of haematopoietic stem cells | Not reported | 1mM | 80 | minutes | 4800 | None | Radioactivity measured with liquid-scintillation counter | Human venous blood sample | in vitro | None | None | Not mentioned | ||
| 10611139 | 1999 | Hexarelin | 6 | Free | Amidation | Linear | Mix | 2me-2-methyl(tryptophan) | Analog of GHRP-6 | Peptidyl growth hormone causing GH releasing effect. | Not reported | 10 to 25 iu of oxytocin | 75.9 ±9.3 | minutes | 4554 | Blood proteases | LC-MS/MS | Intravenous injection,Blood sample from male Sprague-Dawley rats | in vivo | None | None | Not mentioned | ||
| 10611139 | 1999 | Hexarelin | 6 | Free | Amidation | Linear | Mix | 2me-2-methyl(tryptophan) | Analog of GHRP-6 | Peptidyl growth hormone causing GH releasing effect. | Not reported | 5 µg/kg | 71.9 ±11.2 | minutes | 4314 | Blood proteases | LC-MS/MS | Intravenous injection,Blood sample from male Sprague-Dawley rats | in vivo | None | None | Not mentioned | ||
| 10611139 | 1999 | Hexarelin | 6 | Free | Amidation | Linear | Mix | 2me-2-methyl(tryptophan) | Analog of GHRP-6 | Peptidyl growth hormone causing GH releasing effect. | Not reported | 10 µg/kg | 61.4 ±9.5 | minutes | 3684 | Blood proteases | LC-MS/MS | Intravenous injection,Blood sample from male Sprague-Dawley rats | in vivo | None | None | Not mentioned | ||
| 10871321 | 2000 | BK1-5 | 5 | Free | Free | Linear | L | None | Metabolite of bradykinin | Not mentioned | Not reported | 106 cpm/200μl/mouse | ~90 | minutes | 5400 | Aminopeptidase P,Dipeptidyl-peptidaseIV,KininaseII,KininaseI and neutral endopeptidase | HPLC-ESI-MS | Intravenous injection of Bradykinin,Human blood sample | in vivo | None | None | Not mentioned | ||
| 12119302 | 2002 | SA21 | 18 | Acetylation | Amidation | Linear | L | None | Synthetic (Phage display library) | Not mentioned | Not reported | 106 cpm/200μl/mouse | 2.3 | hours | 8280 | Blood proteases | ESI-LC ˆ’MS/MS | Rabbit blood sample | in vivo | None | None | Dissociation equilibrium constant of peptide for albumin,Kd=320 ±22 | ||
| 3799211 | 1986 | (I-deamino-8-D-arginine vasopressin)DDAVP | 9 | 1-β-mercaptopropionic acid | Free | Linear | Mix | None | Modified form of Vasopressin | Antidiuretic agent | Not reported | 90mg | 200 | minutes | 12000 | Plasma proteases | Radioimmunoassay | Blood sample of human uraemic patients(end stage renal failure) | in vivo | US 5500413 A patent | None | Not mentioned | ||
| 1939259 | 1991 | α-BCP(2-9) | 8 | Free | Free | Linear | L | None | Bag cells in the abdominal ganglion of the marine snail Aplysia | Neurotransmitter | Not reported | 10-5 M conc. of peptide | 64 | minutes | 3840 | Aplysia haemolymph proteases | HPLC | Heamolymph of Aplysia | in vitro | None | None | Not given | ||
| 16472750 | 2006 | E2-PEST | 29 | Free | Free | Linear | L | None | E2 protein from papillomavirus | Gene transcription | Not reported | Not mentioned | 63 | minutes | 3780 | in aCSF | Pulse chase experiment | pMEP-E2 CV-1 cell lines | in vitro | 15014086 | None | Not mentioned | ||
| 16472750 | 2006 | E2-PESTP299A | 29 | Free | Free | Linear | L | None | E2 protein from papillomavirus | Gene transcription | Not reported | Not mentioned | 94 | minutes | 5640 | Not mentioned | Pulse chase experiment | pMEP-E2 CV-1 cell lines | in vitro | 15014086 | None | Not mentioned | ||
| 16586064 | 2006 | GLP1 | 30 | Free | Amidation | Linear | L | None | Synthetically synthesized Glucagon-like peptide-1 | Insulinotropic | Not reported | Not mentioned | 114 ±28 | minutes | 6840 | Rat plasma proteases | RP-HPLC | Rat plasma | in vitro | 16505481 | None | 380 ([pmol/l] islet-1 h-1) insulin release at -7 (log [mol/l]) | ||
| 16586064 | 2006 | N-PEG/GLP-1 | 30 | Free | Amidation | Linear | L | Pegylation at N terminus His7 | Synthetically synthesized Glucagon-like peptide-1 analogues | Insulinotropic | Not reported | Not mentioned | 250 ±117 | minutes | 15000 | Rat liver proteases | RP-HPLC | Rat liver homogenate | in vitro | 16505481 | None | 290 ([pmol/l] islet-1 h-1) insulin release at -7 (log [mol/l]) | ||
| 16586064 | 2006 | Lys-PEG/GLP-1 | 30 | Free | Amidation | Linear | L | Pegylation on Lys34 | Synthetically synthesized Glucagon-like peptide-1 analogues | Insulinotropic | Not reported | Not mentioned | 62 ±23 | minutes | 3720 | Rat liver proteases | RP-HPLC | Rat liver homogenate | in vitro | 16505481 | None | 150 ([pmol/l] islet-1 h-1) insulin release at -7 (log [mol/l]) | ||
| 17537541 | 2007 | Vasoactive intestinal peptide (VIP) | 28 | Free | Free | Linear | L | None | Vasoactive intestinal peptide | Neurotransmitter | Not reported | Ki=2.63 ±0.87 nM | 1.38 | hours | 4968 | Not mentioned | Not mentioned | Rat lung alveolar L2 cells | in vitro | None | None | Not given | ||
| 17537541 | 2007 | IK312532 | 31 | Free | Free | Linear | L | None | Synthetic peptide | VIP analogue | Not reported | Ki=1.36 ±0.29 nM | 4.73 | hours | 17028 | Not mentioned | Not mentioned | Rat lung alveolar L2 cells | in vitro | None | None | Not given | ||
| 17640899 | 2007 | T-2410 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.008 µg/ml against IIIB virus | ||
| 17640899 | 2007 | T-2410 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.032 µg/ml against 098 virus | ||
| 17640899 | 2007 | T-2410 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.039 µg/ml against 098-T20 virus | ||
| 17640899 | 2007 | T-2410 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.137 µg/ml against 098-T1249 virus virus | ||
| 17640899 | 2007 | T-2410 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=4.975 µg/ml against 098-T651 virus | ||
| 17640899 | 2007 | T-290676 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.006 µg/ml against IIIB virus | ||
| 17640899 | 2007 | T-290676 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.013 µg/ml against 098 virus | ||
| 17640899 | 2007 | T-290676 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.022 µg/ml against 098-T20 virus | ||
| 17640899 | 2007 | T-290676 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.072 µg/ml against 098-T1249 virus virus | ||
| 17640899 | 2007 | T-290676 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 1.2 | hours | 4320 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=1.314 µg/ml against 098-T651 virus | ||
| 17640899 | 2007 | T-267209 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 3.4 | hours | 12240 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.007 µg/ml against IIIB virus | ||
| 17640899 | 2007 | T-267209 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 3.4 | hours | 12240 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.021 µg/ml against 098 virus | ||
| 17640899 | 2007 | T-267209 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 3.4 | hours | 12240 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.034 µg/ml against 098-T20 virus virus | ||
| 17640899 | 2007 | T-267209 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 3.4 | hours | 12240 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.024 µg/ml against 098-T1249 virus | ||
| 17640899 | 2007 | T-267209 | 38 | Free | Free | Linear | L | None | Synthetic peptide | Antiviral peptide | Not reported | ~1 €“2mg/kg | 3.4 | hours | 12240 | Monkey blood proteases | RP-HPLC and ESI-MS | Male cynomolgus monkey blood plasma (Intravenous) | in vivo | None | None | IC50=0.039 µg/ml against 098-T651 virus | ||
| 18307313 | 2007 | CAP 2 | 2 | Free | NHBn | Linear | L | X= structure given in paper | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 2 | hours | 7200 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 11 µM for S.aureus | ||
| 18307313 | 2007 | CAP 2 | 2 | Free | NHBn | Linear | L | X= structure given in paper | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 2 | hours | 7200 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 11 µM for Methicillin- resistant S.aureus | ||
| 18307313 | 2007 | CAP 2 | 2 | Free | NHBn | Linear | L | X= structure given in paper | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 2 | hours | 7200 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 3 µM for Methicillin- resistant S.epidermis | ||
| 18307313 | 2007 | CAP 8 | 2 | Free | NHBn | Linear | L | X= structure given in paper | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 3 | hours | 10800 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 6 µM for S.aureus | ||
| 18307313 | 2007 | CAP 8 | 2 | Free | NHBn | Linear | L | X= structure given in paper | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 3 | hours | 10800 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 4 µM for Methicillin- resistant S.aureus | ||
| 18307313 | 2007 | CAP 8 | 2 | Free | NHBn | Linear | L | X= structure given in paper | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 3 | hours | 10800 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 3 µM for Methicillin- resistant S.epidermis | ||
| 18307313 | 2007 | CAP 11 | 2 | Free | Y= structure given in paper | Linear | L | Bip | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 2 | hours | 7200 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 7 µM for S.aureus | ||
| 18307313 | 2007 | CAP 11 | 2 | Free | Y= structure given in paper | Linear | L | Bip | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 2 | hours | 7200 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 7 µM for Methicillin- resistant S.aureus | ||
| 18307313 | 2007 | CAP 11 | 2 | Free | Y= structure given in paper | Linear | L | Bip | Synthetic peptide | Antimicrobial | Not reported | 1 mg/mL | 2 | hours | 7200 | Trypsin | RP-HPLC | Trypsin | in vitro | None | None | MIC= 4 µM for Methicillin- resistant S.epidermis | ||
| 18413862 | 2008 | A3-APO (Dimer) | 38 | Chex =Cyclohexane carboxylic acid | Free | Linear | L | Dab =2,4-diamino-butyric acid | Synthetic peptide | Antibacterial | Not reported | 5 mg/kg | 100 | minutes | 6000 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC= 16 mg/mL | ||
| 18413862 | 2008 | A3-APO (Dimer) | 38 | Chex =Cyclohexane carboxylic acid | Free | Linear | L | Dab =2,4-diamino-butyric acid | Synthetic peptide | Antibacterial | Not reported | 5 mg/kg | 230 | minutes | 13800 | Mouse serum proteases | RP-HPLC | Mouse serum | in vitro | None | None | MIC= 16 mg/mL | ||
| 18553094 | 2008 | NT-proBNP | 76 | Free | Free | Linear | L | None | Pro-Brain natriuretic peptide | Vasodilator | Not reported | Not mentioned | ~120 | minutes | 7200 | Human blood proteases | ELISA | Human plasma | in vitro | None | None | Not available | ||
| 19413309 | 2009 | PEG10k-HM-3 | 17 | Methoxypoly(ethylene glycol)-aldehyde (mPEG-ALD) | Free | Linear | L | None | RGD- modified endostatin derived peptide | Antitumor | Not reported | 1mg/ml | 162.08 ± 36.57 | minutes | 9724.8 | Rat blood proteases | RP-HPLC | Rat blood serum (Intravenous injection) | in vivo | None | None | More active in the inhibition of angiogenesis in the chorioallantoic membrane of chick embryos | ||
| 19602537 | 2009 | DualAG | 37 | Free | Cholesterol moiety | Linear | L | None | Proglucagon molecule | Protease-resistant dual GLP1R/GCGR agonist | Not reported | 3mg/kg | 1.7 | hours | 6120 | Mouse blood proteases | RP-HPLC and ESI-MS | Mouse plasma (Subcutaneous injection) | in vivo | None | None | EC 50, cAMP=1.5nM for mGCGR | ||
| 19715558 | 2009 | RIAD | 18 | Free | Free | Linear | L | None | Synthetic peptide | Displaces PKA (protein kinase A) type I from the AKAP (A-kinase-anchoring protein) ezrin | Not reported | Not mentioned | 1.5 | hours | 5400 | Human serum proteases | HPLC | Human serum | in vitro | None | None | Not available | ||
| 19762245 | 2009 | TY027 | 8 | Free | NH-[3 €™,5 €™-(CF3 )2 Bzl] | Linear | Mix | None | Synthetic peptide dreived from opioid and NK1 pharmacophore | Analgesic | Not reported | 50 µg/ml | 4.8 | hours | 17280 | Rat plasma proteases | HPLC | Rat plasma | in vitro | None | None | Not available | ||
| 19762245 | 2009 | TY037 | 8 | Free | NH-[3 €™,5 €™-(CF3 )2 Bzl] | Cyclic (C2-C5) | Mix | None | Synthetic peptide | Analgesic | Not reported | 50 µg/ml | 4.9 | hours | 17640 | Rat plasma proteases | HPLC | Rat plasma | in vitro | None | None | Not available | ||
| 11976797 | 2002 | GLP-1 | 30 | Free | Amidation | Linear | L | Radiolabelling of GLP-1by [123I] | Proglucagon molecule | Antidiabetic | Not reported | 10 MBq of the radiolabelled peptides | 110 ±13 for β phase | minutes | 6600 | Rat blood proteases | Scintigraphy | NEDH Rats (rat tumour model) | in vivo | None | None | Not mentioned | ||
| 11976797 | 2002 | Exendin 3 | 39 | Free | Free | Linear | L | Radiolabelling of exendin 3 at position 1 (histidine) | Heloderma horridum venom | GLP-1 agonist | Not reported | 10 MBq of the radiolabelled peptides | 108 ±16 | minutes | 6480 | Rat blood proteases | Scintigraphy | NEDH Rats (rat tumour model) | in vivo | None | None | Not mentioned | ||
| 16023182 | 2005 | Ã…6 | 8 | Acetylation | Amidation | Linear | L | None | Urokinase plasminogen activator (uPA) | Anti tumor | Not reported | 100mg/ml | 2 | hours | 7200 | Serine Proteases | HPLC, MS-MS | Human blood plasma | in vitro | None | None | Not available | ||
| 18353507 | 2008 | Acetyl-PACAP38 | 38 | Acetylation | Amidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 5.6 ±1.5 nM | ||
| 18353507 | 2008 | Hexanoyl-PACAP38 | 38 | Hexanoylation | Amidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 8.3 ±1.8 nM | ||
| 18353507 | 2008 | [Aib2]PACAP38 | 38 | Free | Amidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | 65 ±8 | minutes | 3900 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 7.1 ±1.4 nM | ||
| 18353507 | 2008 | [D-Ser2]PACAP38 | 38 | Free | Amidation | Linear | Mix | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 9.7 ±2.5 nM | ||
| 18353507 | 2008 | Acetyl-PACAP38-propylamide | 38 | Acetylation | Propylamidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 2.9 ±0.9 nM | ||
| 18353507 | 2008 | Acetyl-PACAP38-hexylamide | 38 | Acetylation | Hexylamidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 3.5 ±0.7 nM | ||
| 18353507 | 2008 | Acetyl-[Ala14, Ala20]PACAP38-propylamide | 38 | Acetylation | Propylamidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 5.3 ±1.7 nM | ||
| 18353507 | 2008 | Acetyl-[Ala15, Ala20]PACAP38-propylamide | 38 | Acetylation | Propylamidation | Linear | L | None | Synthetic analog of PACAP38 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 1.8 ±0.7 nM | ||
| 18353507 | 2008 | PACAP27 | 27 | Free | Amidation | Linear | L | None | Synthetically synthesised pituitary adenylate cyclase-activating polypeptide | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-4 M | >120 | minutes | 7200 | Human plasma proteases | RP-HPLC and MS-MALDI-TOF | Human plasma | in vitro | None | None | IC50 = 9.6 ±2.4 nM | ||
| 18353507 | 2008 | Acetyl-PACAP27 | 27 | Acetylation | Amidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 9.6 ±1.5 nM | ||
| 18353507 | 2008 | Hexanoyl-PACAP27 | 27 | Hexanoylation | Amidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 10.6 ±2.4 nM | ||
| 18353507 | 2008 | [Aib2]PACAP27 | 27 | Free | Amidation | Linear | L | Aib | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | 145 ±23 | minutes | 8700 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 7.9 ±1.8 nM | ||
| 18353507 | 2008 | [D-Ser2]PACAP27 | 27 | Free | Amidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 10.3 ±2.1 nM | ||
| 18353507 | 2008 | Acetyl-PACAP27-propylamide | 27 | Acetylation | Propylamidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 6.7 ±1.2 nM | ||
| 18353507 | 2008 | Acetyl-PACAP27-propylamide | 27 | Acetylation | Propylamidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-4 M | >120 | minutes | 7200 | Human plasma proteases | RP-HPLC and MS-MALDI-TOF | Human plasma | in vitro | None | None | IC50 = 6.7 ±1.2 nM | ||
| 18353507 | 2008 | Acetyl-PACAP27-hexylamide | 27 | Acetylation | Hexylamidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-5 M | >240 | minutes | 14400 | DPP IV | RP-HPLC and MS-MALDI-TOF | DPP IV | in vitro | None | None | IC50 = 5.6 ±1.3 nM | ||
| 18353507 | 2008 | Acetyl-PACAP27-hexylamide | 27 | Acetylation | Hexylamidation | Linear | L | None | Synthetic analog of PACAP27 | Therapeutic Neuropeptide for neurodegenerative diseases. | Not reported | 10-4 M | >120 | minutes | 7200 | Human plasma proteases | RP-HPLC and MS-MALDI-TOF | Human plasma | in vitro | None | None | IC50 = 5.6 ±1.3 nM | ||
| 19041716 | 2009 | LCNP/SST (encapsulated within Liquid crystalline nanoparticles) | 14 | Free | Free | Cyclic (C3-C14) | L | None | Somatostatin encapsulated within Liquid crystalline nanoparticles | Neurotransmitter | Not reported | 1.8 mg/ml | 1.23 ±0.16 | hours | 4428 | Rat blood proteases | ELISA | Rat plasma (Intravenous injection) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 55 µg/kg | 2.335 ±1.732 | hours | 8406 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Men) (Intravenous bolus dose) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 55 µg/kg | 2.774 ±1.797 | hours | 9986.4 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Women) (Intravenous bolus dose) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 110 µg/kg | 2.301 ±0.857 | hours | 8283.6 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Men) (Intravenous bolus dose) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 110 µg/kg | 2.435 ±0.907 | hours | 8766 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Women) (Intravenous bolus dose) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 220 µg/kg | 2.028 ±0.472 | hours | 7300.8 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Men) (Intravenous bolus dose) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 220 µg/kg | 2.931 ±0.971 | hours | 10551.6 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Women) (Intravenous bolus dose) | in vivo | None | None | Not available | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 180 μg/kg plus 2.0 μg/min €¢kg | 2.824 ±0.219 | hours | 10166.4 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Men) (Intravenous bolus followed by a continuous infusion of batifiban injection) | in vivo | None | None | 73.19 ±19.15% inhibition of platelet aggregation | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 180 μg/kg plus 2.0 μg/min €¢kg | 3.032 ±0.383 | hours | 10915.2 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Women) (Intravenous bolus followed by a continuous infusion of batifiban injection) | in vivo | None | None | 63.67 ±21.94% inhibition of platelet aggregation | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 220 μg/kg plus 2.5 μg/min €¢kg | 2.983 ±0.770 | hours | 10738.8 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Men) (Intravenous bolus followed by a continuous infusion of batifiban injection) | in vivo | None | None | 82.91 ±3.96% inhibition of platelet aggregation | ||
| 19224155 | 2009 | Batifiban | 6 | Free | Free | Cyclic (C1-C6) | L | None | Synthetic peptide | Platelet glycoprotein GP …¡b/ …¢a antagonist | Not reported | 220 μg/kg plus 2.5 μg/min €¢kg | 3.120 ±0.322 | hours | 11232 | Human blood plasma proteases | HPLC, MS-MS | Human blood plasma (Women) (Intravenous bolus followed by a continuous infusion of batifiban injection) | in vivo | None | None | 88.98 ±11.615 inhibition of platelet aggregation | ||
| 21334413 | 2011 | Exendin-4 | 39 | Free | Free | Linear | L | None | Venom of the lizard Heloderma suspectum | Binds and activates the GLP-1 receptor | Not reported | 500 μg/kg | 2.4 | hours | 8640 | Rat blood proteases | Radioimmunoassay | Rat plasma | in vitro | None | None | Not mentioned | ||
| 21664938 | 2011 | GLP-1 | 30 | Free | Free | Linear | L | None | Proglucagon molecule | Anti-hyperglycemic hormone | Not reported | 300 μg/kg | <2 | hours | 7200 | Rat blood proteases | ELISA | Serum of rats (Subcutaneous injection) | in vivo | None | None | Binding constants to the GLP-1 receptor= 27.62 ± 2.13nM | ||
| 8910426 | 1996 | LALF-10 (38 €“45) | 12 | Free | Free | Cyclic (C2-C11) | L | None | Analogue of Limulus anti-lipopolysaccharide factor | Antibacterial | Not reported | 2.5 µg/ml | 77 | minutes | 4620 | Proteases present in fetal calf serum | RP-HPLC | Fetal calf serum | in vitro | None | None | LD50=2.58 mg/ml | ||
| 8910426 | 1996 | LALF-14 (36 €“47) | 16 | Free | Free | Cyclic (C2-C15) | L | None | Analogue of Limulus anti-lipopolysaccharide factor | Antibacterial | Not reported | 2.5 µg/ml | 84 | minutes | 5040 | Proteases present in fetal calf serum | RP-HPLC | Fetal calf serum | in vitro | None | None | LD50=2.33 mg/ml | ||
| EP2090589A1 | 2009 | DX-890 | 56 | Free | Free | Linear | L | None | Kunitz domain peptide | Protease inhibitor | N.A. | Not mentioned | 165 | minutes | 9900 | Rabbit blood proteases | I-125 radiolabelling method | Rabbit plasma (Intravenous) | in vivo | None | EP2090589A1 | Inhibition constt (Ki) 6 ±1 pM | ||
| EP2090589A1 | 2009 | DX-890 | 56 | Free | Free | Linear | L | None | Kunitz domain peptide | Protease inhibitor | N.A. | Not mentioned | 79.44 | minutes | 4766.4 | Mouse blood proteases | I-125 radiolabelling method | Mouse plasma (Intravenous) | in vivo | None | EP2090589A1 | Not mentioned | ||
| US7112567B2 | 2006 | Derivative of Glucagon Like Peptide-2 (GLP-2) | 33 | Free | Amidation | Linear | L | None | GLP-2 | Intestine function modulator | N.A. | 500 nM/ Kg | 1.5 | hours | 5400 | Rat blood proteases | Radioimmunoassay | Rat plasma (Intravenous) | in vivo | None | US7112567B2 | Increase in wet-weight of small intestine >0.5 g | ||
| WO2013106273A2 | 2013 | SP16 | 13 | Free | Free | Linear | L | None | Human alpha-1-antitrypsin | Anti-inflammatory and immune modulator peptide | N.A. | 5 mg/ Kg | 1.9 | hours | 6840 | Rat blood proteases | LC-MS/MS | Rat plasma (Intravenous) | in vivo | None | WO2013106273A2 | Not mentioned | ||
| WO2012138867A2 | 2012 | Intermedin or adrenomedullin peptide | 39 | Free | Free | Linear | L | None | Preproadrenomedullin | Calcium homeostasis | N.A. | Not mentioned | 1.5 | hours | 5400 | Rat blood proteases | ELISA | Rat plasma (Intravenous) | in vivo | None | WO2012138867A2 | Not mentioned | ||
| WO2009027844 | 2009 | Human Corticotropic releasing factor (hCRF) | 41 | Free | Free | Linear | L | None | Hypothalamus | Inhibitor of edema and inflammation | N.A. | 100 micro g/ Kg | 62.6 | minutes | 3756 | Not mentioned | ELISA | Rat plasma (Subcutaneous) | in vivo | None | WO2009027844 | Not mentioned | ||
| WO2009027844 | 2009 | Human Corticotropic releasing factor (hCRF) | 41 | Free | Free | Linear | L | None | Hypothalamus | Inhibitor of edema and inflammation | N.A. | 1000 micro g/ Kg | 72.1 | minutes | 4326 | Not mentioned | ELISA | Rat plasma (Subcutaneous) | in vivo | None | WO2009027844 | Not mentioned | ||
| US6656906 | 2003 | T1249 | 39 | Acetylation | Amidation | Linear | L | None | Hybrid of anti-HIV peptide and peptide derived from virus glycoproteins | Anti-HIV peptide | N.A. | 1.2 mg/ Kg | 2.02 | hours | 7272 | Not mentioned | HPLC | Rat plasma (Subcutaneous) | in vivo | None | US6656906 | Fold fusion-inhibition (CEM cells and Molt-4 cells) with respect to T20 (DP-178) against HIV2-NIH-Z strain 840 Fold | ||
| US6656906 | 2003 | T1249 | 39 | Acetylation | Amidation | Linear | L | None | Hybrid of anti-HIV peptide and peptide derived from virus glycoproteins | Anti-HIV peptide | N.A. | 1.5 mg/ Kg | 2.46 | hours | 8856 | Rat blood proteases | HPLC | Rat plasma (Intravenous) | in vivo | None | US6656906 | Not mentioned | ||
| US6656906 | 2003 | T1249 | 39 | Acetylation | Amidation | Linear | L | None | Hybrid of anti-HIV peptide and peptide derived from virus glycoproteins | Anti-HIV peptide | N.A. | 0.8 mg/ kg | 4.83 | hours | 17388 | Not mentioned | HPLC | Monkey plasma (Subcutaneous) | in vivo | None | US6656906 | Not mentioned | ||
| US6656906 | 2003 | T1249 | 39 | Acetylation | Amidation | Linear | L | None | Hybrid of anti-HIV peptide and peptide derived from virus glycoproteins | Anti-HIV peptide | N.A. | 15 mg/ Kg | 2 | hours | 7200 | Not mentioned | HPLC | Rat plasma (Subcutaneous) | in vivo | None | US6656906 | Not mentioned | ||
| US6656906 | 2003 | T1249 | 39 | Acetylation | Amidation | Linear | L | None | Hybrid of anti-HIV peptide and peptide derived from virus glycoproteins | Anti-HIV peptide | N.A. | 5 mg/ Kg | 1.86 | hours | 6696 | Rat blood proteases | HPLC | Rat plasma (Intravenous) | in vivo | None | US6656906 | Not mentioned | ||
| 12954066 | 2003 | KK1 | 13 | Free | Free | Linear | L | N3-L-Hlys at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 153 ±4 | minute | 9180 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK2 | 13 | Free | Free | Linear | L | N3-1d= COOH-CH(NH2)CH2-(CH2)3-CH2-NHMe at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 211 ±6 | minute | 12660 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK3 | 13 | Free | Free | Linear | L | N3-2= COOH-CH(NH2)CH2-(CH2)3-CH2-NMe2at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 126 ±18 | minute | 7560 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK4 | 13 | Free | Free | Linear | L | N3-3= COOH-CH(NH2)CH2-(CH2)3-CH2-NMe2at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 103 ±10 | minute | 6180 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK5 | 13 | Free | Free | Linear | L | N3-L-lys at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 136 ±6 | minute | 8160 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK6 | 13 | Free | Free | Linear | L | N3-4d= COOH-CH(NH2)CH2-(CH2)3-CH2-NHMe at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 128 ±6 | minute | 7680 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK7 | 13 | Free | Free | Linear | L | N3-5d= COOH-CH(NH2)CH2-(CH2)3-CH2-NMe2 at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 127 ±2 | minute | 7620 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK8 | 13 | Free | Free | Linear | L | N3-6d= COOH-CH(NH2)CH2-(CH2)3-CH2-+NMe3 at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 128 ±30 | minute | 7680 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK9 | 13 | Free | Free | Linear | L | N3-L-Orn at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 134 ±27 | minute | 8040 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK10 | 13 | Free | Free | Linear | L | N3-7d= COOH-CH(NH2)CH2-(CH2)3-CH2-+NHMe at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 131 ±27 | minute | 7860 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK11 | 13 | Free | Free | Linear | L | N3-8d= COOH-CH(NH2)CH2-(CH2)3-CH2-Nme2 at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 126 ±9 | minute | 7560 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK12 | 13 | Free | Free | Linear | L | N3-9d= COOH-CH(NH2)CH2-(CH2)3-CH2-+Nme3 at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 216 ±33 | minute | 12960 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 12954066 | 2003 | KK15 | 13 | Free | Free | Linear | L | N3-L-Arg at 8th arginine position | Derivative of Bovine hypothalamus | Induction of cyclic nucleotide production, intracellular calcium influx, Na+K+-ATPase activation, muscle relaxation, decreased food consumption, catalepsy,decreased locomotion, hypothermia, antinociception, antipsychosis | Not mentioned | 1.07mM | 174 ±7 | minute | 10440 | Rat serum protease | MALDI-TOF-MS | Rat serum | in vitro | None | None | Biological effect of peptide is evaluated by binding to its receptor i.e hNTR. Cell membranes are tansfected with either hNTR-1 or hNTR-2 were incubated with 0.4 nM 125I-Tyr (3)-NT (2000 Ci/mmol) and various concentrations of unlabeled NT, or NT analogue.Total binding 8500 and nonspecific binding 2500 for 70 μg of protein per formed on whole cells. | ||
| 385880 | 1979 | 5-Fluoro-4-(N -succinamoyl-L-alanyl-L-leucine)-2-(1H)-pyrimidone (compound 12) | 2 | 5-Fluoro-4-N-succinamoyl | 2-(1H)-pyrimidone | Linear | L | Conjugation of peptide C terminal carboxyl group with amino group of 5 Fluorocytosine | Synthetic | Anticandidal | Not given | Not mentioned | 1.7 | hour | 6120 | Sample cells proteases | Spectrophotometry | Sample cells | in vivo | None | None | 5-FC peptide were tested for antifungal activity agaainst S. cerevisiae, Candida albicans and candida. The MIC was 0.31,0.31 and 10 µg/mL respectively. | ||
| 385880 | 1979 | 5-Fluoro-4-(N-succinamoyl-L-alanyl-L-leucine benzyl ester)-2(1H)-pyrimidone (compound 9) | 2 | 5-Fluoro-4-N-succinamoyl | Benzyl ester-2(1H)-pyrimidone | Linear | L | Conjugation of peptide C terminal carboxyl group with amino group of 5 Fluorocytosine | Synthetic | Anticandidal | Not given | Not mentioned | 1.1 | hour | 3960 | Sample cells proteases | Spectrophotometry | Sample cells | in vivo | None | None | 5-FC peptide were tested for antifungal activity agaainst S. cerevisiae, Candida albicans and candida. The MIC was 0.31,0.62 and 20 ug/mL respectively. | ||
| 385880 | 1979 | 5-Fluoro-4-(N -succinamoyl-L-leucyl-L-leucine)-2(1 H)-pyrimidone (compound13) | 2 | 5-Fluoro-4-N-succinamoyl | 2-(1H)-pyrimidone | Linear | L | Conjugation of peptide C terminal carboxyl group with amino group of 5 Fluorocytosine | Synthetic | Anticandidal | Not given | Not mentioned | 2.9 | hour | 10440 | Sample cells proteases | Spectrophotometry | Sample cells | in vivo | None | None | 5-FC peptide were tested for antifungal activity agaainst S. cerevisiae, Candida albicans and candida. The MIC was 0.31,0.31 and 10 µg/mL respectively. | ||
| 385880 | 1979 | N4-( Boc-Ala-Gly)-5-FC (compound 17) | 2 | N4- Boc | 5-FC (5 Fluorocytosine) | Linear | L | Conjugation of peptide C terminal carboxyl group with amino group of 5 Fluorocytosine | Synthetic | Anticandidal | Not given | Not mentioned | 2.3 | hour | 8280 | Sample cells proteases | Spectrophotometry | Sample cells | in vivo | None | None | 5-FC peptide were tested for antifungal activity agaainst S. cerevisiae, Candida albicans and candida. The MIC was 0.62, 0.62 and 1.25 ug/mL respectively. | ||
| 4034413 | 1985 | Leucine enkephalin analogue | 5 | Free | Free | Linear | L | Thiomethylene bond replacement between residue 1-2 | Derivative of Natural enkephalin | Analgesic | 20 minutes | 0.9 nM | 94 | minute | 5640 | Human serum protease | HPLC | Human serum | in vitro | None | None | Not reported | ||
| 4034413 | 1985 | Leucine enkephalin analogue | 5 | Free | Free | Linear | L | Thiomethylene bond replacement between residue 2-3 | Derivative of Natural enkephalin | Analgesic | 20 minutes | 0.9 nM | 79.4 | minute | 4764 | Human serum protease | HPLC | Human serum | in vitro | None | None | Not reported | ||
| 6605972 | 1984 | Ovine corticotropic releasing factor | 41 | Free | Free | Linear | L | None | Paraventricular nucleus (PVN) of the hypothalamus | Used as a diagnostic test in disease affecting the Hypothalamic pituitary axis | 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. | 76 μg | 70.8 (t1/2 slow) | minute | 4248 | Human blood plasma proteases | Radioimmunoassay and HPLC analysis | Intravenous administration to human plasma | in vivo | http://www.anaspec.com/products/product.asp?id=322 | None | Not reported | ||
| 6605972 | 1984 | Ovine corticotropic releasing factor | 41 | Free | Free | Linear | L | None | Paraventricular nucleus (PVN) of the hypothalamus | Used as a diagnostic test in disease affecting the Hypothalamic pituitary axis | 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. | 75 μg | 95.4 (t1/2 slow) | minute | 5724 | Human blood plasma proteases | Radioimmunoassay and HPLC analysis | Intravenous administration to human plasma | in vivo | http://www.anaspec.com/products/product.asp?id=322 | None | Not reported | ||
| 6605972 | 1984 | Ovine corticotropic releasing factor | 41 | Free | Free | Linear | L | None | Paraventricular nucleus (PVN) of the hypothalamus | Used as a diagnostic test in disease affecting the Hypothalamic pituitary axis | 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. | 75 μg | 90.8 (t1/2 slow) | minute | 5448 | Human blood plasma proteases | Radioimmunoassay and HPLC analysis | Intravenous administration to human plasma | in vivo | http://www.anaspec.com/products/product.asp?id=322 | None | Not reported | ||
| 6605972 | 1984 | Ovine corticotropic releasing factor | 41 | Free | Free | Linear | L | None | Paraventricular nucleus (PVN) of the hypothalamus | Used as a diagnostic test in disease affecting the Hypothalamic pituitary axis | 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. | 80 μg | 83.5 (t1/2 slow) | minute | 5010 | Human blood plasma proteases | Radioimmunoassay and HPLC analysis | Intravenous administration to human plasma | in vivo | http://www.anaspec.com/products/product.asp?id=322 | None | Not reported | ||
| 6605972 | 1984 | Ovine corticotropic releasing factor | 41 | Free | Free | Linear | L | None | Paraventricular nucleus (PVN) of the hypothalamus | Used as a diagnostic test in disease affecting the Hypothalamic pituitary axis | 0, 2, 5, 7,10,15, 20, 25, 30, 45, 60, 90, 120, 150, and 180 min. | 80 μg | 73.0 (mean t1/2 slow) | minute | 4380 | Human blood plasma proteases | Radioimmunoassay and HPLC analysis | Intravenous administration to human plasma | in vivo | http://www.anaspec.com/products/product.asp?id=322 | None | Not reported | ||
| 6658706 | 1983 | 125I-labeled desamino-tyrosyl (DAT-FPA) FPA | 16 | Free | Free | Linear | L | DAT-FPA was labeled with 125-iodine or with 123-iodine by chloramine-T | Desaminotyrosine Fibrinopeptide derivative | Blood clotting | 8 sec and at 10 sec intervals upto 2 mins, then after 6,10,20,30,40,60,90,120,150,210 and 240 min | Labeled 125-I-FPA (0.1 mCi) in 1 ml of 1 µg of FPA | 180 (radioactivity) | minute | 10800 | Normal rabbit blood proteases | Gel filtration chromatography of blood plasma at different time interval show that rapid clearence of peptide from blood plasma. | Intravenous injection in lateral vein of normal rabbit | in vivo | http://search.anaspec.com/?keywords=fibrinopeptide | None | Not reported | ||
| 6658706 | 1983 | Human Fibrinopeptide A (FPA) | 16 | Free | Free | Linear | L | None | N terminal end of the A-alpha chain of fibrinogen | Blood clotting | 12 sec and at 10 sec intervals upto 2 mins, then after 6,10,20,30,40,60,90,120,150,210 and 240 min | Labeled 125-I-FPA (0.1 mCi) in 1 ml of 1 µg of FPA | 90 | minute | 5400 | Normal rabbit blood proteases | Gel filtration chromatography of blood plasma at different time interval show that rapid clearence of peptide from blood plasma. | Intravenous injection in lateral vein of normal rabbit | in vivo | None | None | Not reported | ||
| 8839678 | 1995 | Glucagon like peptide 1 (GLP( 7-36)) | 36 | Free | Amidation | Linear | L | None | Human intestinal epithelium | Gastric motility | 5, 10, 20, 40, 60, 90, 120, 240, 300 and 360 min | 400 pmol/l | 68 ±6 (for final phase) | minute | 4080 | Dog plasma proteases | Radioimmunoassay and HPLC | Intravenous injection to dogs plasma | in vitro | None | None | Bacitracin proteolytoic assay. When plasma sample incubated with 0.1% of bacitracin half life is increased. | ||
| 8839678 | 1995 | Glucagon like peptide 1 (GLP( 7-37)) | 37 | Free | Free | Linear | L | None | Human intestinal epithelium | Gastric motility | 5, 10, 20, 40, 60, 90, 120, 240, 300 and 360 min | 400 pmol/l | 81 ±3 (for final phase) | minute | 4860 | Dog plasma proteases | Radioimmunoassay and HPLC | Intravenous injection to dogs plasma | in vitro | http://www.anaspec.com/products/product.asp?id=324 | None | Bacitracin proteolytoic assay. When plasma sample incubated with 0.1% of bacitracin half life is increased. | ||
| 8839678 | 1995 | Glucagon like peptide 1 (GLP( 7-36)) | 36 | Free | Amidation | Linear | L | None | Human intestinal epithelium | Gastric motility | 5, 10, 20, 40, 60, 90, 120, 240, 300 and 360 min | 400 pmol/l | 132 ±16 | minute | 7920 | Dog plasma proteases | Radioimmunoassay and HPLC | Subcutaneous injection into dog plasma | in vitro | None | None | Bacitracin proteolytoic assay. When plasma sample incubated with 0.1% of bacitracin half life is increased. | ||
| 8839678 | 1995 | Glucagon like peptide 1 (GLP( 7-37)) | 37 | Free | Free | Linear | L | None | Human intestinal epithelium | Gastric motility | 5, 10, 20, 40, 60, 90, 120, 240, 300 and 360 min | 400 pmol/l | 61 ±9 | minute | 3660 | Dog plasma proteases | Radioimmunoassay and HPLC | Subcutaneous injection into dog plasma | in vitro | http://www.anaspec.com/products/product.asp?id=324 | None | Bacitracin proteolytoic assay. When plasma sample incubated with 0.1% of bacitracin half life is increased. | ||
| 8839678 | 1995 | Glucagon like peptide 1 (GLP( 7-37)) | 37 | Free | Free | Linear | L | None | Human intestinal epithelium | Gastric motility | 5, 10, 20, 40, 60, 90, 120, 240, 300 and 360 min | 400 pmol/l | 238 ±35 | minute | 14280 | Dog plasma proteases | Radioimmunoassay and HPLC | Subcutaneous injection into dog plasma in presence of bacitracin | in vitro | http://www.anaspec.com/products/product.asp?id=324 | None | Bacitracin proteolytoic assay. When plasma sample incubated with 0.1% of bacitracin half life is increased. | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 2,5,10,20,30,45,60,90,120,180,240,300,360, 480,600, and 1440min | 0.10mg/kg | 64 (t1/2 β) | minute | 3840 | Dog blood plasma proteases | HPLC-MS | Intravenous administered to Dog | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 2, 5, 10, 30, 60, 90, 120, 180, 240, 300, 360, 480, and 1440min | 0.10mg/kg | 64 (t1/2 β) | minute | 3840 | Rabbit blood plasma proteases | HPLC-MS | Intravenous administered to Rabbit | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 2, 5, 10, 30, 60, 90, 120, 180, 240, 300, 360, 480, and 1440min | 0.10mg/kg | 68 (t1/2 β) | minute | 4080 | Monkey blood plasma proteases | HPLC-MS | Intravenous administered to Monkey | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min | 5 mg/kg | 73 (t1/2 β) | minute | 4380 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min | 50 mg/kg | 80 | minute | 4800 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min | 300 mg/kg | 99 | minute | 5940 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min | 500 mg/kg | 122 | minute | 7320 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 5, 10, 20, 30, 45, 60, 90, 120, 150, and 180min | 1000 mg/kg | 204 | minute | 12240 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 28 day | 5 mg/kg | 74 | minute | 4440 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 1 day | 50 mg/kg | 80 | minute | 4800 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 28 day | 50 mg/kg | 71 | minute | 4260 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 1 day | 300 mg/kg | 99 | minute | 5940 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 28 day | 300 mg/kg | 100 | minute | 6000 | Rat blood plasma proteases | HPLC-MS | Orally administered to Rat | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 1 day | 300 mg/kg | 75 | minute | 4500 | Dog blood plasma proteases | HPLC-MS | Orally administered to Dog | in vivo | None | None | Not tested | ||
| 8991489 | 1996 | IRI-695 peptide | 3 | Acetylation | Isobutyl citrate | Linear | L | C14 Radiolabeling | Synthetic | Anxiolytic and antidepressant | 28 day | 300 mg/kg | 76 | minute | 4560 | Dog blood plasma proteases | HPLC-MS | Orally administered to Dog | in vivo | None | None | Not tested | ||
| 9062685 | 1997 | Analogue of [Cys6]AVP(5-8) | 4 | Free | Free | Linear | L | None | Human kidney cells | Antidiuretic hormone | 5, 10, 30, 60 and 120 min | 10 ng/kg | 223 | minute | 13380 | Rat blood proteases | HPLC | Subcutaneously injected to rat | in vivo | None | None | Passive avoidance test to check the learning behaviour and response latency is measured of movement from light compartement to dark compartement. The peptide decreased the latency period significantly and also effective at 100 fold lower cincentration than then other drugs. | ||
| 9589822 | 1998 | Eptifibatide | 7 | Mpr=mercaptopropionyl | Amidation | Cyclic (disulfide bridge between cysteine and mercaptopropionyl) | L | None | Venom of pygmy rattlesnake | Antithrombotic | 1.5, 2, 4, 6, 8, 12, 16, 24, 36, 48, 60, and 72 hours | 135 μg/kg | 1.13 ±0.17 (t1/2 termination) | hours | 4068 | Human blood plasma proteases | HPLC | Intravenous injection to Human | in vitro | http://www.prospecbio.com/Eptifibatide_11_124/ | None | Not tested | ||
| 9589822 | 1998 | Eptifibatide | 7 | Mpr=mercaptopropionyl | Amidation | Cyclic (disulfide bridge between cysteine amide and mercaptopropionyl) | L | None | Venom of pygmy rattlesnake | Antithrombotic | 1.5, 2, 4, 6, 8, 12, 16, 24, 36, 48, 60, and 72 hours | 135 μg/kg | 5 ±2.5 (t1/2 distribution) | hours | 18000 | Human blood plasma proteases | HPLC | Intravenous injection to Human | in vitro | http://www.prospecbio.com/Eptifibatide_11_124/ | None | Not tested | ||
| 10354413 | 1999 | Thioimreg compound 8 | 3 | Free | Free | Linear | L | Peptide bonds at position 2,3 was replaced by thioamide linkage | Thioanalogue of natural Imreg | Immunostimulant | 3.5 hours | Not given | >180 | minute | 10800 | Rat blood proteases | HPLC | Rat whole blood | in vitro | None | None | A weak in vitro induction of T (PHA) and B (PWM) cell proliferation (1.5 to 2-fold increase) by the thioanalogues | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | None | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse plasma proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse plasma | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para chlorination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse plasma proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse plasma | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para bromination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse plasma proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse plasma | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para florination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse plasma proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse plasma | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para iodination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse plasma proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse plasma | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin | 6 | Free | Amidation | Linear | L | None | Natural (Human brain) | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse brain proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse brain proteases | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Hydroxylation of amino group of Phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse brain proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse brain proteases | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para chlorination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse brain proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse brain proteases | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para bromination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse brain proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse brain proteases | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para florination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse brain proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse brain proteases | in vitro | None | None | Not tested | ||
| 10573295 | 1999 | Enkephalin analog | 6 | Free | Free | Linear | L | Para iodination of amino group of phenylalanine | Derivative of Natural enkephalin | Analgesic | 0, 60, 120, 180, and 300 min | 1mM | >300 | minute | 18000 | Mouse brain proteases | HPLC , reverse phase HPLC, Partition coefficient | Mouse brain proteases | in vitro | None | None | Not tested | ||
| 11145579 | 2001 | Insulin like growth factor 1 (IGF-1) | 70 | Free | Free | Linear | L | I125 radiolabeling | Human IGF-1 | Regulate somatic growth and cellular proliferation | 1, 5, 15, and 30 min and at 1, 2, 4, 8, and 24 h | 15 μCi(0.2 ml) | 1.22 ±0.237 (t1/2 β) | hours | 4392 | Rat blood proteases | TCA precipitation | Intravenous injection into rat | in vivo | PMID:7758431 | None | Human articular cartilage explant is taken and cultured in humidified environment, explant is treated with 40ng/ml of IGF-1, E3A,F49A for 5 days. Proteoglycan synthesis(matrix) synthesis is increased ~ 3 times in E3A/F49A treated sampleas compare to control as measured by scientillation counter. | ||
| 1824807 | 1991 | naP-2 (Neutrophil-activatingprotein-2) | 70 | Free | Free | Linear | L | None | beta- thromboglobulin | Inflammatory peptide | 48 hours | 20 pmol/site | 65-75 | minutes | 4200 | Rabbit blood proteases | Not mentioned | Intradermal injection in rabbit | in vivo | None | None | P- 2 elicited inflammatory responses (neutrophil emigration, edema formation at 20 pmol/l | ||
| 7911441 | 2014 | Octreotide | 8 | Free | Free | Cyclic (C2-C7) | L | None | Somatostatin analogue | Growth Hormone Inhibitor | Not mentioned | 125 μg/kg | 113 | minutes | 6780 | Patient blood proteases | Not mentioned | Patients with severe renal impairment | in vivo | None | None | Octreotide considerably inhibits pentagastrin stimulated gastric acid secretion and significantly diminishes exocrine pancreatic function. | ||
| 9040091 | 1997 | Meterelin | 9 | Free | Ethylamide | Linear | Mix | pGlu=pyroglutamic acid | Gonadotropic cells in the anterior pituitary gland | Behavior influencing hormones | 5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an | 10 μg/kg | 106 ±22 (t1/2 β) | minutes | 6360 | New Zeland female rabbits blood protease | Radioimmunoassay | Intravenous injected in New Zeland female rabbits | in vivo | None | None | Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days | ||
| 9040091 | 1997 | Meterelin | 9 | Free | Ethylamide | Linear | Mix | pGlu=pyroglutamic acid | Gonadotropic cells in the anterior pituitary gland | Behavior influencing hormones | 5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an | 1 μg/kg | 112 ±41 (t1/2 β) | minutes | 6720 | New Zeland female rabbits blood protease | Radioimmunoassay | Subcutaneous injected in New Zeland female rabbits | in vivo | None | None | Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days | ||
| 9040091 | 1997 | Meterelin | 9 | Free | Ethylamide | Linear | Mix | pGlu=pyroglutamic acid | Gonadotropic cells in the anterior pituitary gland | Behavior influencing hormones | 5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an | 10 μg/kg | 103 ±19 (t1/2 β) | minutes | 6180 | New Zeland female rabbits blood protease | Radioimmunoassay | Subcutaneous injected in New Zeland female rabbits | in vivo | None | None | Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days | ||
| 9040091 | 1997 | Meterelin | 9 | Free | Ethylamide | Linear | Mix | pGlu=pyroglutamic acid | Gonadotropic cells in the anterior pituitary gland | Behavior influencing hormones | 5, 1, 3, 5, 7, 10, 15, 20, 30, 45, 60, 75, and 90 min, then every 30 min until 3 h postinjection, an | 100 μg/kg | 173 ±13 (t1/2 β) | minutes | 10380 | New Zeland female rabbits blood protease | Radioimmunoassay | Subcutaneous injected in New Zeland female rabbits | in vivo | None | None | Castrate levels of testosterone were attained 10 days after sc administration of the implant, lasted for up to 247 days | ||
| 18937214 | 2009 | Carbofuran (methylcarbamyl-)-labeled tryptic peptide | 29 | Free | Free | Linear | L | Methylcarbamylated at serine (position 8) | Human Bche protein | Pesticide | Not mentioned | Not mentioned | 2 | hours | 7200 | Human blood proteases | HPLC | Human serum | in vivo | None | None | BChE activity was 88% inhibited at time zero, but became less inhibited with time as carbofuran was released from the active site Ser 198. | ||
| 7522585 | 1994 | Antagonist D [D-Arg1,D-Phe5,D-Trp7,9,Leu11]-SP | 22 | Free | Free | Linear | Mix | None | Substance P (SP) analogue | Anticancer drugs | 1, 2, 5 and 24 hours | 10 μg/ml | 4.6 | hours | 16560 | Mouse liver proteases | RP-HPLC and Electrochemical Detection | Mouse liver homogenate | in vitro | None | None | Act as growth factors | ||
| 7522585 | 1994 | Antagonist G [Arg6, D-Trp7,9, MePhe8] - substance P (6-11) | 17 | Free | Free | Linear | Mix | Methylation of phenylalanine at 3rd position | Substance P (SP) analogue | Anticancer drugs | 1, 2, 5 and 24 hours | 0.1 μg/ml | 4.4 | hours | 15840 | Human plasma proteases | RP-HPLC and Electrochemical Detection | Human plasma | in vitro | None | None | Act as growth factors | ||
| 8020889 | 1994 | SMS 201-995 (Somatostatin analog octreotide) | 8 | Free | Free | Cyclic (C2-C7) | Mix | None | Somatostatin analogue | Growth Hormone Inhibitor | 2 hours | 2 nmol | 1.2 ±0.2 (elimination half life) | hours | 4320 | Rat plasma proteases | Liquid scintillation counting | Injected into mesenteric veins rat | in vivo | None | None | Peptides bound with high affinity and specificity to rat cortex membranes with pIC50= 9.53 ± 0.07 | ||
| 8020889 | 1994 | N-α-(α-D-glucosyl(1-4)-1-deoxy-D-fructosyl)-octreotide-SDZ CO-611 | 8 | N-alpha-(alpha-D-glucosyl(1-4)-1-deoxy-D-fructosyl) | Free | Cyclic (C2-C7) | Mix | None | Somatostatin analogue | Growth Hormone Inhibitor | 2 hours | 2 nmol | 1.9 ±0.3 (elimination half life) | hours | 6840 | Rat plasma proteases | Liquid scintillation counting | Injected into mesenteric veins rat | in vivo | None | None | Peptides bound with high affinity and specificity to rat cortex membranes with pIC50= 9.53 ± 0.08 | ||
| 8289671 | 1994 | Octreotide | 8 | Free | Free | Cyclic (C2-C7) | Mix | None | Somatostatin | Growth Hormone Inhibitor | 60 minutes | 30 ng/kg/min | 90 | minutes | 5400 | Human serum proteases | Not mentioned | Human serum | in vivo | 6128648 | None | It is a potent and well-tolerated inhibitor of basal and stimulated secretion of endogenous insulin, glucagon, and growth hormone when given intravenous infusion at a rate of 30 ng/ kg/min | ||
| 8353526 | 1993 | Trypsin modulating oostatic factor (TMOF) | 10 | Acetylation | Free | Linear | L | None | A. aegypti ovary | Growth regulatory peptide | Not mentioned | Not mentioned | 1.6 | hours | 5760 | Mosquito ovary endopeptidases | Radioimmunoassay | Ovaries of A. aegypti, Culex quinquefasciatus and Anopheles quadrimaculatus | in vivo | None | None | At concentrations of 3 x 10-9 M and 6.8 x 10-6 M, TMOF inhibited 50 and 90% of trypsin-like enzyme biosynthesis, respectively. | ||
| 8545241 | 1995 | Dynorphin A (DYN A) analog-2 | 17 | Free | Free | Linear | L | The reduced bond psi [CH,-NH] was introduced at position 1-2 | Opoid | Physiological effect regulating peptide | 0-60 minutes | 100 μM peptide solution to 0.18-ml portions of brain membranes | 67 | minutes | 4020 | Endopeptidase 24-11 (enkephalinase), mouse brain proteases | HPLC | Mouse brain homogenates | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A (DYN A) analog-4 | 17 | Free | Free | Linear | L | The reduced bond psi [CH,-NH] was introduced at position 4-5 | Opoid | Physiological effect regulating peptide | 0-60 minutes | 100 μM peptide solution to 0.18-ml portions of brain membranes | 100 | minutes | 6000 | Endopeptidase 24-11 (enkephalinase), mouse brain proteases | HPLC | Mouse brain homogenates | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A (DYN A) analog-6 | 17 | Free | Free | Linear | L | The reduced bond psi [CH,-NH] was introduced at position 6-7 | Opoid | Physiological effect regulating peptide | 0-60 minutes | 100 μM peptide solution to 0.18-ml portions of brain membranes | 80 | minutes | 4800 | Endopeptidase 24-11 (enkephalinase), mouse brain proteases | HPLC | Mouse brain homogenates | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A (DYN A) analog-7 | 17 | Free | Free | Linear | L | The reduced bond psi [CH,-NH] was introduced at position 7-8 | Opoid | Physiological effect regulating peptide | 0-60 minutes | 100 μM peptide solution to 0.18-ml portions of brain membranes | 192 | minutes | 11520 | Endopeptidase 24-11 (enkephalinase), mouse brain proteases | HPLC | Mouse brain homogenates | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A (DYN A) analog-8 | 17 | Free | Free | Linear | L | The reduced bond psi [CH,-NH] was introduced at position 8-9 | Opoid | Physiological effect regulating peptide | 0-60 minutes | 100 μM peptide solution to 0.18-ml portions of brain membranes | 191 | minutes | 11460 | Endopeptidase 24-11 (enkephalinase), mouse brain proteases | HPLC | Mouse brain homogenates | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A (DYN A) analog-9 | 17 | Free | Free | Linear | L | The reduced bond psi [CH,-NH] was introduced at position 9-10 | Opoid | Physiological effect regulating peptide | 0-60 minutes | 100 μM peptide solution to 0.18-ml portions of brain membranes | 93 | minutes | 5580 | Endopeptidase 24-11 (enkephalinase), mouse brain proteases | HPLC | Mouse brain homogenates | in vitro | None | None | Not reported | ||
| 8545255 | 1995 | Hexarelin | 6 | Free | Free | Linear | Mix | Methylated at position 2 of D-trp | Growth hormone-releasing hormone-6 | Growth hormone-releasing peptide | 0.5, 1, 2, 3, 5, 10, 15, 20, 30,40, 60, 80, 120, 150, 240, and 300 min | 1 μg/kg | 119.84 ±22.5 | minutes | 7190.4 | Dog blood proteases | Radioimmunoassay | Intravenous injection to male and female dogs | in vivo | None | None | Not reported | ||
| 19165353 | 2009 | NT pro-BNP (N-terminal Pro-Brain natriuretic Peptide) | 76 | Free | Free | Linear | L | None | Brain Natriuretic Peptide | Diuretic,natriuretic and vasodilatory peptide | Not mentioned | Not mentioned | 60-120 | minutes | 5400 | Human plasma proteases | Not mentioned | Human plasma | in vitro | http://www.phoenixpeptide.com/catalog/product_info | None | NT-pro-BNP is an independent predictor of postoperative myocardial injury in patients undergoing vascular surgery | ||
| 19805567 | 2010 | Enfuvirtide | 36 | Acetylation | Free | Linear | L | 19 residue is N15 labelled, also have 13C carbon | Enfuvirtide | Antiretroviral fusion inhibitor | 5, 15, and 30 min and 1, 2, 4, 8, 24, and 48 h after drug injection | dose, 4 mg/kg of body weight | 2.8 | hours | 10080 | Wistar rats blood protease | LC-MS/MS | Female Wistar rats | in vivo | None | None | Showed an EC50 of about 275 nM | ||
| 17583927 | 2007 | Cell penetrating peptides-Phosphorodiamidate morpholino oligomers (CPP-PMO) | 34 | Free | PMO (5'-ACGTTGAIIIGCATCGTCGC-3') | Linear | L | X = 6-aminohexanoic acid, B = beta-alanine, I = inosine | Cell penetrating peptides-Phosphorodiamidate morpholino oligomers | Cell penetrating peptide | 24 hours | 150 mg/kg | 1.56 ±0.10 (t1/2 α) | hours | 5616 | Rat plasma proteases | MALDI-TOF-MS | Intravenous administration in Rat | in vitro | None | None | LD50 of the conjugate administered iv in rats was between 210 and 250 mg/kg | ||
| 17682073 | 2007 | NC100668 | 13 | Acetylation | Tc chelator (NC100194) | Linear | L | Tyr residue at 8 position is Iodionated | Cell penetrating peptides-Phosphorodiamidate morpholino oligomers | Tracer tested for nuclear medical imaging | 1, 1.5, 3, 6, 12, and 24 hours | 20, 100, 500, 1000, and 2000 μg | 1.2 | hours | 4320 | Human plasma proteases | LC-MS | Injected in human plasma | in vivo | None | None | Not reported | ||
| 17704241 | 2007 | FROPDOTA | 13 | Free | lys coupled to the chelator DOTA (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid) | Linear | L | 111In radiolabeling | Somatostatin receptor-binding octreotide | Tumor-Targeting Peptide | 1, 2, 5, 15, 30, 60, and 120 min | 200 μl | 71 | minutes | 4260 | Human serum proteases | Radioimmunoassay and RP-HPLC | Human serum | in vitro | None | None | The inhibition constant was 494 nM. | ||
| 3871610 | 1985 | Rat α1- proteinase inhibitor | 60 | Free | Free | Linear | L | Glycosylation | Rat serum | Protelytic activities regulating peptide | 5 minutes, 30 minutes, 1 hour, 4 hour and 7 hour | Not mentioned | 170 (for glycosylated α1- proteinase inhibitor) | minutes | 10200 | Rat serum proteases | Radioimmunoassay | Wistar rats | in vivo | http://www.uniprot.org/uniprot/Q9JMK6 | None | Protect tissue against proteolytic attack by leukocyte elastase | ||
| 6433008 | 1984 | TAP-144 | 10 | Free | Ethylamide | Linear | Mix | pGlu=pyroglutamic acid, des-Gly | LHRH derivative | Gonadotrophins secreting hormone | 10 days | 1μg/100g body wt | 90.6 (t1/2 terminal phase) | minutes | 5436 | Rat serum proteases | Not mentioned | Vaginal administration to Sprague-Dawley rats | in vivo | None | None | Serum LH and FSH concentrations declined to about the same low level by 8 h after the TAP- 144 administration | ||
| 6433008 | 1984 | TAP-144 | 10 | Free | Ethylamide | Linear | Mix | pGlu=pyroglutamic acid, des-Gly | LHRH derivative | Gonadotrophins secreting hormone | 10 days | 10μg/100g body wt | 109.8 (t1/2 terminal phase) | minutes | 6588 | Rat serum proteases | Not mentioned | Vaginal administration to Sprague-Dawley rats | in vivo | None | None | Serum LH and FSH concentrations declined to about the same low level by 8 h after the TAP- 144 administration | ||
| 18586440 | 2008 | NT pro-BNP (N-terminal pro B-type natriuretic peptide) | 76 | Free | Free | Linear | L | None | B-type Natriuretic peptide | Diuretic, Natriuretic and vasodilatory peptide | Not mentioned | Not mentioned | 120 | minutes | 7200 | Human serum proteases | Not mentioned | Humans | in vivo | http://www.phoenixpeptide.com/catalog/product_info | None | NT-pro-BNP (using a cutoff value of >308 pg/mL) is an independent predictor of postoperative myocardial injury in patients undergoing vascular surgery | ||
| 10607940 | 2000 | Insulin-like growth factor-I (IGF-I) | 70 | Free | Free | Linear | L | I125 labeling | Human IGF-1 | Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow | 5, 30, 120 and 240 min | 100 μl | 203 ±10.2 (t1/2β) | minutes | 12180 | Rat blood proteases | Radioimmunoassay and bi-exponential equation that describes a two-compartment model | Intravenous bolus administration in Rat | in vivo | 632300 | None | infusion of 125I-IGF-I into rats, 0 ·003 ±0 ·001% (mean ±S.E.M, n=6) of total infused, intact 125I-IGF-I had appeared per milliliter of wound fluid. | ||
| 10607940 | 2000 | Insulin-like growth factor-I (IGF-I) | 70 | Free | Free | Linear | L | I125 labeling | Human IGF-1 | Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow | 5, 30, 120 and 240 min | 100 μl | 185.4 ±4.7 (t1/2β) | minutes | 11124 | Rat blood proteases | Radioimmunoassay and bi-exponential equation that describes a two-compartment model | Intravenous bolus administration in Rat | in vivo | 632300 | None | infusion of 125I-IGF-I into rats, 0 ·003 ±0 ·001% (mean ±S.E.M, n=6) of total infused, intact 125I-IGF-I had appeared per milliliter of wound fluid. | ||
| 10607940 | 2000 | LR(3) insulin-like growth factor-I (IGF-I) | 83 | Free | Free | Linear | L | I125 labeling | Analogue of IGF-I | Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow | 5, 30, 120 and 240 min | 100 μl | 111.1 ±3.9 (t1/2β) | minutes | 6666 | Rat blood proteases | Radioimmunoassay and bi-exponential equation that describes a two-compartment model | Intravenous bolus administration in Rat | in vivo | http://www.cellsciences.com/content/p-detail.asp?r | None | At 5 min 0 ·01 ± 0 ·001% (mean ± S.E.M, n = 6, P < 0 ·001) of total infused intact 125I-LR3IGF-I had appeared per milliliter of wound fluid. | ||
| 10607940 | 2000 | LR(3) insulin-like growth factor-I (IGF-I) | 83 | Free | Free | Linear | L | I125 labeling | Analogue of IGF-I | Promotes formation and repair of bone, stimulates body protein and glucose metabolism and increases glomerular filtration rate and renal plasma flow | 5, 30, 120 and 240 min | 100 μl | 140.2 ±2.5 (t1/2β) | minutes | 8412 | Rat blood proteases | Radioimmunoassay and bi-exponential equation that describes a two-compartment model | Intravenous bolus administration in Rat | in vivo | http://www.cellsciences.com/content/p-detail.asp?r | None | At 5 min 0 ·01 ± 0 ·001% (mean ± S.E.M, n = 6, P < 0 ·001) of total infused intact 125I-LR3IGF-I had appeared per milliliter of wound fluid. | ||
| 4327730 | 1971 | ACTH analogue- 6 | 18 | Free | Amidation | Linear | L | βAla = Beta alanine, Orn = Ornithine | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | Not mentioned | 76.2 (lipolytic activity t1/2) | minutes | 4572 | Rat plasma proteases | Not mentioned | Rat plasma | in vitro | 4286483 | None | Similar or higher activity in rat than in rabbit (rat = 0.4*10-6mg/50mg tissue and rabbit = 0.1*10-6mg/50mg tissue | ||
| 4327730 | 1971 | ACTH analogue- 7 | 18 | Free | Amidation | Linear | L | Ibu = α-aminoisobutyric acid | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | Not mentioned | 80.63 (lipolytic activity t1/2) | minutes | 4837.8 | Rat plasma proteases | Not mentioned | Rat plasma | in vitro | 4286483 | None | Similar or higher activity in rat than in rabbit (rat = 0.06*10-6mg/50mg tissue and rabbit = 0.5*10-6mg/50mg tissue | ||
| 4327730 | 1971 | ACTH analogue- 8 | 18 | Free | Amidation | Linear | Mix | βAla = Beta alanine, Orn = Ornithine | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | Not mentioned | 88.12 (lipolytic activity t1/2) | minutes | 5287.2 | Rat plasma proteases | Not mentioned | Rat plasma | in vitro | 4286483 | None | Similar or higher activity in rat than in rabbit (rat = 0.07*10-6mg/50mg tissue and rabbit = 0.2*10-6mg/50mg tissue | ||
| 4327730 | 1971 | Purified Sheep Adrenocorticotropic Hormone (ACTH) | 39 | Free | Free | Linear | L | None | Sheep Adrenocorticotropic Hormone (ACTH) | Steroidogenic peptides | 1,2,3 and 4 hours | 200 mU | 250.87 (lipolytic activity t1/2) | minutes | 15052.2 | Rat muscle proteases | Not mentioned | Rat muscle slices | in vitro | http://www.genscript.com/peptide/RP11304-ACTH_1-39 | None | Not mentionedtive ACTH shows similar activity to rat and rabbit fats when compared in terms of the minimal effective dose (rat = 6*10-6mg/50mg tissue and rabbit = 5*10-6mg/50mg tissue) | ||
| 4327730 | 1971 | ACTH analogue- 4 | 18 | Free | Amidation | Linear | L | βAla = Beta alanine | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | 20 μg | 88.2 (lipolytic activity t1/2) | minutes | 5292 | Rat muscle proteases | Not mentioned | Rat muscle slices | in vitro | 4286483 | None | Showed much higher activity in rabbit fat than in rat fat (rat = 0.6*10-6mg/50mg tissue and rabbit = 0.07*10-6mg/50mg tissue) | ||
| 4327730 | 1971 | ACTH analogue- 5 | 18 | Free | Amidation | Linear | L | Ibu = α-aminoisobutyric acid | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | 20 μg | 122.88 (lipolytic activity t1/2) | minutes | 7372.8 | Rat muscle proteases | Not mentioned | Rat muscle slices | in vitro | 4286483 | None | Showed much higher activity in rabbit fat than in rat fat (rat = 0.2*10-6mg/50mg tissue and rabbit = 0.002*10-6mg/50mg tissue) | ||
| 4327730 | 1971 | ACTH analogue- 6 | 18 | Free | Amidation | Linear | L | βAla = Beta alanine, Orn = Ornithine | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | Not mentioned | 102.62 (lipolytic activity t1/2) | minutes | 6157.2 | Rat muscle proteases | Not mentioned | Rat muscle slices | in vitro | 4286483 | None | Similar or higher activity in rat than in rabbit (rat = 0.4*10-6mg/50mg tissue and rabbit = 0.1*10-6mg/50mg tissue | ||
| 4327730 | 1971 | ACTH analogue- 7 | 18 | Free | Amidation | Linear | L | Ibu = α-aminoisobutyric acid | Octadecapeptide analogues of ACTH | Steroidogenic peptides | 1,2,3 and 4 hours | Not mentioned | 261.78 (lipolytic activity t1/2) | minutes | 15706.8 | Rat muscle proteases | Not mentioned | Rat muscle slices | in vitro | 4286483 | None | Similar or higher activity in rat than in rabbit (rat = 0.06*10-6mg/50mg tissue and rabbit = 0.5*10-6mg/50mg tissue | ||
| 8218482 | 1993 | RGD containing peptide | 5 | Free | Free | Linear | L | None | Extra Cellular Matrix proteins | Antitumor peptide | Not mentioned | 0.2 mL | 2.7 (t1/2 second phase) | hours | 9720 | Mice blood proteases | Radioimmunoassay | Intravenously injected to C57BL6 mice | in vivo | None | None | Less effective in in blocking peptide-mediated attachment of B16-FlO melanoma cells to a surface. | ||
| 8403527 | 1993 | Calcitonin gene-related peptide (CGRP) | 37 | Free | Free | Linear | L | None | Human Vasopressin | Vasoactive peptide | 2,4,6,8, 10, 15,20,25,30,40,50,60 and 90 min. | Not mentioned | 63.9 ±4.5 | minutes | 3834 | Rat kidney proteases | Not mentioned | Isolated perfused rat kidney | in vivo | http://www.uniprot.org/blast/?about=P06881[83-119] | None | Not reported | ||
| 15828822 | 2005 | Compond 5 (ABT-526) | 9 | Acetylation | N-Ethylmaleimidation | Linear | Mix | Sar- Sarcosine | Synthetic (derived from peptide 1) | Antiangiogenic activity | Not mentioned | 5mg/kg | 1.2 | hours | 4320 | Mouse plasma proteases | Not mentioned | Mouse plamsa | in vivo | None | None | Inhibition of HMVEC migration with IC50 = 0.03 ± 0.015 nM, Inhibition of HMVEC tube formation with IC50 = 200-100nM | ||
| 15828822 | 2005 | Compond 6 (ABT-510) | 9 | Acetylation | N-Ethylmaleimidation | Linear | Mix | 4th AA is D isoform of allo- Ile, Sar- Sarcosine | Synthetic (derived from peptide 1) | Antiangiogenic activity | Not mentioned | 5mg/kg | 1.2 | hours | 4320 | Monkey plasma proteases | Not mentioned | Monkey plasma | in vivo | None | None | Inhibition of HMVEC migration with IC50 = 0.89 ± 0.029 nM, Inhibition of HMVEC tube formation with IC50 = 10-50nM | ||
| 15828822 | 2005 | Compound 10 | 9 | Succinylation | N-Ethylmaleimidation | Linear | Mix | Sar- Sarcosine , NMeNva- N-methyl-norvaline | Synthetic (derived from peptide 1) | Antiangiogenic activity | Not mentioned | 5mg/kg | 2.1 | hours | 7560 | Rat plasma proteases | Not mentioned | Rat plasma | in vivo | None | None | Inhibition of HMVEC migration with IC50 =0.45 ± 0.110 nM, Inhibition of HMVEC tube formation with IC50 = 10 -5nM | ||
| 16287259 | 2005 | H12 (Fibrinogen γ chain dodecapeptide) | 12 | Free | Free | Linear | L | conjugated with PEG | Derived from Fibrinogen gamma chain | Induce Thrombosis | Not mentioned | 40mg/kg peptide infused | 200 ±23 | minutes | 12000 | Proteases from (thrombocytopenic rats)plasma | Spectrofluorometer | Rat(thrombocytopenic)plasma | in vivo | None | None | 10 mg/kg slightly reduced the Bleeding time to 573 ± 127 seconds in comparison control group 618 ± 51 seconds | ||
| 17408666 | 2007 | Cydiastatin 4-alpha | 13 | Free | Amidation | Linear | L | None | Synthetic | Neuropeptides | 30 °C for 20 minutes | 1nmol | 71 | minutes | 4260 | M. sexta larval midgut tissue extract proteases | RP-HPLC | Midgut tissues of M. sexta | in vitro | None | None | Not reported | ||
| 17408666 | 2007 | Cydiastatin 4-alpha | 12 | Free | Amidation | Linear | L | Acpc=cyclopropylalanine | Synthetic | Neuropeptides | 30 °C for 20 minutes | 1nmol | 116 | minutes | 6960 | M. sexta larval midgut tissue proteases | RP-HPLC | Midgut tissue | in vitro | None | None | Not reported | ||
| 17532097 | 2007 | N/OFQ (Nociceptin/Orphanin FQ peptide receptor) | 17 | Free | Free | Linear | L | None | Derived from the prepronociceptin protein | NOP-Receptor ligands | 37 °C for 240 min | 6 μg/μl | 64 ±1 | minutes | 3840 | Mouse plasma proteases | RP-HPLC | Mouse Plasma | in vitro | None | None | Hypotensive and bradycardic effects evoked by N/OFQ after i.v. administration in rats, was lasting (about 10 min) | ||
| 17532097 | 2007 | UFP-112 (Nociceptin/Orphanin FQ receptor antagonist) | 17 | Free | Amidation | Linear | L | (pF)F = p-flouro Phenylalanine; Aib= 2-Aminoisobutyric acid | Synthetic | NOP-Receptor ligands | 37 °C for 240 min | 6 μg/μl | 167 ±9 | minutes | 10020 | Mouse plasma proteases | RP-HPLC | Mouse Plasma | in vitro | 20497197 | None | Hypotensive and bradycardic effects evoked by UFP-112 after i.v. administration in rats wast lasting for (i.e. 80 min | ||
| 17766836 | 2003 | Neurotensin (NT) | 13 | Free | Free | Linear | L | Pyr-Glu= pyro-glutamate | Neurotransmitter-like hypothalamic peptide | Regulates luteinizing hormone and prolactinrelease | 37 °C for 2-24 hours | Not mentioned | <2 | hours | 7200 | Human plasma proteases | HPLC-MS | Human plasma | in vivo | None | None | Tetra-branched NT(8-13)-methotrexate cause 60% reduction in tumor growth was observed with respect to mice treated with free drug | ||
| 18249125 | 2009 | Prostate Specific Antigen (Prodrug 3) | 5 | Mu (Morpholino) | Cyclopamine | Linear | L | None | Synthetic | Prostate-specific antigen (PSA)-activated prodrugs against prostate cancer | 0.5-18 hours at room temperature | 100 µM | 3.2 | hours | 11520 | PSA enzymes | Hydrolysis and RP-HPLC | NA | in vitro | None | None | Not reported | ||
| 21185160 | 2011 | O-1(Oncocin) | 19 | Free | Amidation | Linear | L | None | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 68 ±15 | minutes | 4080 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 8 μg/mL M.luteus | ||
| 21185160 | 2011 | O-2 (Oncocin) | 18 | Free | Free | Linear | L | None | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 120 | minutes | 7200 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 64 μg/mL in E.coli BL21A1 and 128 μg/mL M.luteus | ||
| 21185160 | 2011 | O-4 (Oncocin) | 19 | Free | Amidation | Linear | L | None | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 120 | minutes | 7200 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC =16μg/mL in E.coli BL21A1 and 64 μg/mL M.luteus | ||
| 21185160 | 2011 | O-5 (Oncocin) | 19 | Free | Amidation | Linear | L | None | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 90 ±1 | minutes | 5400 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 16 μg/mL in E.coli BL21A1 and 16 μg/mL M.luteus | ||
| 21185160 | 2011 | O-6 (Oncocin) | 19 | Free | Amidation | Linear | L | Orn=Ornithine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 210 ±60 | minutes | 12600 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and 16 μg/mL M.luteus | ||
| 21185160 | 2011 | O-7 (Oncocin) | 19 | Free | Amidation | Linear | L | Agp = α-amino-3-guanidinopropionic acid | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 98 ±6 | minutes | 5880 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and 8μg/mL M.luteus | ||
| 21185160 | 2011 | O-8 (Oncocin) | 19 | Free | Amidation | Linear | L | Nir=Nitro-arginine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 78 ±2 | minutes | 4680 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and 16 μg/mL M.luteus | ||
| 21185160 | 2011 | O-9 (Oncocin) | 19 | Free | Amidation | Linear | L | Nmr =N-methylarginine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 79 ±3 | minutes | 4740 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and 4 μg/mL M.luteus | ||
| 21185160 | 2011 | O-10 (Oncocin) | 19 | Free | Amidation | Linear | L | Har=Homoarginine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 94 ±1 | minutes | 5640 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and8 μg/mL M.luteus | ||
| 21185160 | 2011 | O-11 (Oncocin) | 19 | Free | Amidation | Linear | Mix | D-Arg at 19th position | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 160 ±5 | minutes | 9600 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 4μg/mL in E.coli BL21A1 | ||
| 21185160 | 2011 | O-12 (Oncocin) | 19 | Free | Propylamidation | Linear | L | None | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | >120 | minutes | 7200 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 8 μg/mL M.luteus | ||
| 21185160 | 2011 | O-14 (Oncocin) | 19 | Free | Amidation | Linear | L | orn =Ornithine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 90 | minutes | 5400 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and 16 μg/mL M.luteus | ||
| 21185160 | 2011 | O-15 (Oncocin) | 19 | Free | Amidation | Linear | L | Beta-Hr =β-homoarginine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 150 | minutes | 9000 | Mouse serum proteases | MALDI-TOF-MS | 25% mouse serum | in vivo | None | None | MIC = 4μg/mL in E.coli BL21A1 and 16 μg/mL M.luteus | ||
| 21185160 | 2011 | O-18 (Oncocin) | 19 | Free | Amidation | Linear | L | Har=Homoarginine, Agp = α-amino-3-guanidinopropionic acid | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 62 ±4 | minutes | 3720 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 4 μg/mL M.luteus | ||
| 21185160 | 2011 | O-19 (Oncocin) | 19 | Free | Amidation | Linear | L | Har=Homoarginine, Agp = α-amino-3-guanidinopropionic acid | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 111 ±6 | minutes | 6660 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 2 μg/mL M.luteus | ||
| 21185160 | 2011 | O-20 (Oncocin) | 19 | Free | Amidation | Linear | L | Agp = α-amino-3-guanidinopropionic acid | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 171 ±20 | minutes | 10260 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC =8 μg/mL in E.coli BL21A1 and 4 μg/mL M.luteus | ||
| 21185160 | 2011 | O-21 (Oncocin) | 19 | Free | Amidation | Linear | L | Har=homoarginine, Orn=Ornithine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 75 ±1 | minutes | 4500 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 4 μg/mL M.luteus | ||
| 21185160 | 2011 | O-22 (Oncocin) | 19 | Free | Amidation | Linear | L | Agp = α-amino-3-guanidinopropionic acid, Orn=Ornithine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 103 ±5 | minutes | 6180 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 4 μg/mL M.luteus | ||
| 21185160 | 2011 | O-23(Oncocin) | 19 | Free | Amidation | Linear | L | Orn=Ornithine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 176 ±8 | minutes | 10560 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC = 8 μg/mL in E.coli BL21A1 and 8 μg/mL M.luteus | ||
| 21185160 | 2011 | O-25 (Oncocin) | 19 | Free | Propylamidation | Linear | L | Orn=Ornithine | 2kDa Oncopeltus peptide derivatives | Antimicrobial | 30-480 Minutes | 7.5 μg/100μl | 102 ±2 | minutes | 6120 | Mouse serum proteases | MALDI-TOF-MS | Full mouse serum | in vivo | None | None | MIC = 4 μg/mL in E.coli BL21A1 and 8 μg/mL M.luteus | ||
| 22263969 | 2012 | 2m (monomer Atrial natriuretic peptide- Fc ) | 39 | Free | Fc region | Cyclic (C7-C23 & C-residues of Fc region) | L | None | Synthetic ANP peptides linked to the N-terminus of recombinantly expressed Fc using native chemical ligation. | Natriuretic and vasodilator | 4-72 hours | 0.5mg/kg of protein | 3.9 | hours | 14040 | Rat plasma proteases | ELISA | Female Wistar rats Plasma | in vivo | None | None | Not reported | ||
| 22263969 | 2012 | 3m (monomer Atrial natriuretic peptide- Fc ) | 42 | Free | Fc region | Cyclic (C7-C23 & C-residues of Fc region) | L | None | Synthetic ANP peptides linked to the N-terminus of recombinantly expressed Fc using native chemical ligation. | Natriuretic and vasodilator | 4-72 hours | 0.5mg/kg of protein | 4.5 | hours | 16200 | Rat plasma proteases | ELISA | Female Wistar rats Plasma | in vivo | None | None | Not reported | ||
| 22263969 | 2012 | 2d (Atrial natriuretic peptide- Fc dimer) | 78 | Free | Fc region | Cyclic (C7-C23 & C-residues of Fc region) | L | None | Synthetic ANP peptides linked to the N-terminus of recombinantly expressed Fc using native chemical ligation. | Natriuretic and vasodilator | 4-72 hours | 0.5mg/kg of protein | 2.8 | hours | 10080 | Rat plasma proteases | ELISA | Female Wistar rats Plasma | in vivo | None | None | Not reported | ||
| 24588343 | 2014 | GLP-1(9-36)(Glucagon Like protein-1) | 28 | Free | Amidation | Linear | L | None | Glucagon Like protein-1 (GLP-1) | Vasodialator | 5-120 minutes | 10mg/ml | >240 | minutes | 14400 | Serum and plasma proteases | LC-MS | Male beagle dog plasma | in vitro | None | None | Not reported | ||
| 24588343 | 2014 | GLP-1(9-36)(Glucagon Like protein-1) | 28 | Free | Amidation | Linear | L | None | Glucagon Like protein-1 (GLP-1) | Vasodialator | 4 hours at 37C | 1 µM | >110 | minutes | 6600 | Dog hepatocyte proteases | LC-MS | Male beagle dog hepatocyte | in vitro | None | None | Not reported | ||
| 25039358 | 2014 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | Derived from Saliva of Gila monster | GLP-1 receptor agonist | 37 °C for 2-72 hours | 1000ng/ml | 4.8 | hours | 17280 | Rat plasma proteases | LC-MS/MS | Rat Plasma | in vitro | None | None | GLP-1 receptor Activation potency with EC50 =1.6 ± 0.4 pM in HEK-293 cells | ||
| 25039358 | 2014 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | Derived from Saliva of Gila monster | GLP-1 receptor agonist | 37 °C for 2-72 hours | 1000ng/ml | 2.5 ±1.2 | hours | 9000 | Rat plasma proteases | LC-MS/MS | Rat Plasma | in vivo | None | None | GLP-1 receptor Activation potency with EC50 =1.6 ± 0.4 pM in HEK-293 cells | ||
| 25243635 | 2014 | VGLP1 (Glucagon like peptide 1 derivative) | 31 | Free | Free | Cyclic (C18-C26) | L | None | Glucagon Like protein-1 (GLP-1) | Antihyperglycemic | 37 °C for 0.1-24 hours | 500μg | <5 | hours | 18000 | DPP IV | ELISA | DPP IV | in vitro | None | None | Not reported | ||
| 25243635 | 2014 | VGLP1V6 (Glucagon like peptide 1 derivative) | 37 | Free | Free | Cyclic (C12-C20) | L | None | Glucagon Like protein-1 (GLP-1) | Antihyperglycemic | 37 °C for 0.1-24 hours | 500μg | ~ 5 | hours | 18000 | DPP IV | ELISA | DPP IV | in vitro | None | None | Not reported | ||
| 25324697 | 2014 | SHSMP(Sadat-Habdan Mesenchymal stimulating Peptide) | 13 | Free | Free | Linear | L | None | SHSMP(Sadat-Habdan Mesenchymal stimulating Peptide) | Angiogenesis Factor | Blood sample collected after 30-480 minutes after the infusion of peptide | 5mg/kg | 90 | minutes | 5400 | Rat plasma proteases | HPLC | Sprague Dawley rats (Dose i/m injected) | in vivo | Patent US7399826 B1 | None | Not reported | ||
| 25894376 | 2015 | P7 (Basic fibroblast growth factor- binding peptide) | 7 | Free | Free | Linear | L | None | Basic Fibroblast growth factor 2- binding peptide | Anti-proliferative and anti-angiogenic | 37 °C for 1-48hours | 0.3478μM | 1.5 | hours | 5400 | Human plasma proteases | HPLC | Human plasma | in vitro | 20414975 | None | Not reported | ||
| 25594223 | 2015 | ENF(Enfuvirtide) | 36 | Acetylation | Amidation | Linear | L | None | Enfuvirtide | Anti-viral (Anti-HIV activity) | 0.5-24 hours | 1.7μM/Kg | 1.5 | hours | 5400 | Rat plasma proteases | HPLC | Sprague-Dawey (SD) rats Plasma | in vivo | None | None | EC50 = 3nM for Anti-viral potency | ||
| 25594223 | 2015 | Lac-ENF (Lactic acid Enfuvirtide) | 37 | Lactic acid | Amidation | Linear | L | None | Synthetic derived from glycosylated ENFs | Anti-viral | 0.5-24 hours | 1.7μM/Kg | 4.2 | hours | 15120 | Rat plasma proteases | HPLC | Sprague-Dawey (SD) rats Plasma | in vivo | None | None | EC50 = 2nM for Anti-viral potency | ||
| 25771000 | 2015 | Exendin-4 | 39 | Free | Free | Linear | L | None | GLP-1 derived peptide | Regulate blood glucose | 0.5-24 hours | 0.5 mg/kg | 3.03 | hours | 10908 | db/db mice plasma proteases | LC-MS/MS | db/db Mice plasma (Dose i/v injected) | in vivo | None | None | AUC for glucose -stimulated 1st phase insulin secretion in Exendin-4 -treated mice (20nmol/kg) is 1.62 fold higher than control | ||
| 25771000 | 2015 | Exendin-4 | 39 | Free | Free | Linear | L | None | GLP-1 derived peptide | Regulate blood glucose | 0.5-24 hours | 0.5 mg/kg | >3 | hours | 10800 | Rabbit plasma proteases | LC-MS/MS | New Zealand White Rabbit plasma (Dose i/v injected) | in vivo | None | None | AUC for glucose -stimulated 1st phase insulin secretion in Exendin-4 -treated mice (20nmol/kg) is 1.62 fold higher than control | ||
| 25900863 | 2015 | TRI-1144 | 38 | Acetylation | Amidation | Linear | L | None | Synthetic derived from SPPS with an acetylated N-terminus and amidated C-terminus. | HIV-fusion inhibitor | Blood sample collected after 1-168 hours after the infusion of peptide | 800nmol/Kg dose injected | 4.2 | hours | 15120 | Rat plasma proteases | LC-MS/MS | Intravenously administered to Sprague €“Dawley rats | in vivo | None | None | Not reported | ||
| 26197931 | 2015 | Porcine-PYY(1-36) | 36 | Free | Free | Linear | L | None | Synthetic peptide hormone released from enteroendocrine cells | Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner) | 37 °C for 24 hours | Not mentioned | 3.4 ±0.2 | hours | 12240 | Pig blood proteases | Radioimmunoassay and HPLC | Female pigs blood + Peptide sample+ DPP-IV inhibitor (valine pyrrolidide) | in vitro | None | None | Human PYY 3 €“36 signaled through the Y-2 receptor in COS-7 cells with potency with EC50 = 3.5nmol/L | ||
| 26222180 | 2015 | G36A or [GLP-1(7-36A)] | 30 | Free | Amidation | Linear | L | None | Glucagon-like peptide 1 (GLP-1) | Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner) | Room Temp | 0.4 µM | 4 ±0.2 | hours | 14400 | Human plasma proteases + DPP IV | MS | Citrate + Human plasma | in vitro | None | None | Not reported | ||
| 26222180 | 2015 | G36A or [GLP-1(7-36A)] | 30 | Free | Amidation | Linear | L | None | Glucagon-like peptide 1 (GLP-1) | Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner) | Room Temp | 0.4 µM | 4 ±0.2 | hours | 14400 | Human serum proteases + DPP IV | MS | Serum | in vitro | None | None | Not reported | ||
| 26222180 | 2015 | G36A or [GLP-1(7-36A)] | 30 | Free | Amidation | Linear | L | None | Glucagon-like peptide 1 (GLP-1) | Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner) | Room Temp | 0.4 µM | 2 ±0.4 | hours | 7200 | Human blood proteases + DPP IV | MS | EDTA whole blood | in vitro | None | None | Not reported | ||
| 26222180 | 2015 | G 37 or [GLP-1(7 €“37)] | 31 | Free | Free | Linear | L | None | Glucagon-like peptide 1 (GLP-1) | Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner) | On ice | 0.4 µM | 5 ±1.0 | hours | 18000 | Human blood proteases + DPP IV | MS | EDTA whole blood | in vitro | None | None | Not reported | ||
| 26308095 | 2015 | Exenatide | 39 | Free | Amidation | Linear | L | None | Saliva of Gila monster | Regulates blood glucose by upregulating the insulin secretion | Blood sample collected after7-288 hours after the injection of peptide | 5nmol/Kg | 02-Mar | hours | 9000 | Proteases from mini-pig plasma | ELISA, LC/MS | Mini-pigs plasma (Dose s/c injected) | in vivo | None | None | Not reported | ||
| 26325323 | 2015 | Compound 1(lactose [Q1][w6]LHRH ) | 10 | Lactose | Amidation | Linear | L | Lactose at N-ter, pyro-Glutamine at n-ter, D-Trp at 6 pos | Hypothalamus | Stimulates pitutiary gland to secretes to release gonadotropins(LH, FSH) | Blood sample collected after0.5-24 hours after the injection of peptide | 2.5mg/Kg | 2.9 ±0.63 | hours | 10440 | Rat plasma proteases | LC/MS | Rat Plasma (Dose i/v injected) | in vivo | None | None | Increase in the level of LH was observed i.e. nAUC = 11.33 ± 1.65 ng/24 hafter oral administration of 20 mg/kg of compound 1 compared to the control nAUC = 4.45 ± 1.028 ng/24 h | ||
| 26325323 | 2015 | Compound 1(lactose [Q1][w6]LHRH ) | 10 | Lactose | Amidation | Linear | L | Lactose at N-ter, pyro-Glutamine at n-ter, D-Trp at 6 pos | Hypothalamus | Stimulates pitutiary gland to secretes to release gonadotropins(LH, FSH) | Blood sample collected after0.5-24 hours after the injection of peptide | 10mg/Kg | 2.6 ±0.84 | hours | 9360 | Rat plasma proteases | LC/MS | Rat Plasma (Dose i/p injected) | in vivo | None | None | Increase in the level of LH was observed i.e. nAUC = 11.33 ± 1.65 ng/24 hafter oral administration of 20 mg/kg of compound 1 compared to the control nAUC = 4.45 ± 1.028 ng/24 h | ||
| 26400022 | 2015 | Peptide S2 (Hirudin mimetic peptide) | 22 | Free | Amidation | Linear | Mix | Stearic acid at Lys | Hirudin derived | Anti-coagulant | Not mentioned | 1.0μM/Kg | 212.2 ±58.4 | minutes | 12732 | Rat plasma proteases | HPLC, MS-MS | Sprague-Dawley (SD) rats plasma (Dose i/v injected) | in vivo | None | None | Inhibition constant for peptides (Ki, nM) in rat thrombin €“catalyzed hydrolysis of Chromozym TH with Ki 15.24 ± 0.18 nM; Inhibition constant for peptides (Ki, nM) in human thrombin €“catalyzed hydrolysis of Chromozym TH with Ki 11.75 ± 0.46nM | ||
| 21459096 | 2011 | DNP (Dendroaspis natriuretic peptide) | 39 | Free | Free | Cyclic (C7-C23) | L | None | Dendroaspis natriuretic peptide | Natriuretic and hypotensive activities | 37 °C for 0-125 minutes | Not mentioned | 159 | minutes | 9540 | Human kidney proteases | Not mentioned | Human kidney membrane extract | in vitro | 19395584 | None | Not reported | ||
| 19157421 | 2009 | NNZ-2566 (Glycyl-L-2-methylprolyl-L- glutamic acid) | 3 | Free | Free | Linear | L | Methylation of alpha-C of Pro | Glypromate analogue | Neuroprotective | Blood collected after 0.5-12 hours after peptide delivery | 3 -10 mg/kg/h dose | 74 | minutes | 4440 | Rat brain proteases | LC-MS | Sprague-Dawley rats blood (Dose i/v injected) | in vivo | None | None | NNZ-2566-treated animals(i/v) exhibited an average infarct area of 79.8 ±10.4 mm2 (3 mg/kg/h, pb0.01) and 21.3 ±7.5 mm2 (10 mg/kg/h) as compare to ET-1 induced an infarct area of 153.1 ±20.1 mm2 (mean ±s.e.m) in saline-treated rat; Total injury size was 22.2 ±5.7 mm2 following 30 mg/kg (76% protection; Dunnett's multiple comparison test) and only 4.6 ±2.3 mm2 following 60 mg/kg (95% protection; Dunnett's multiple comparison test). | ||
| 21903490 | 2011 | cTP6( Cyclic thymic hexapeptide) | 6 | Free | Free | Cyclic (Amide bond between C1-Y6) | L | None | Synthetic analog of TP5(Thymopentin) | Immunomodulatory drug | Blood collected after 5 minutes-8 hours after peptide delivery | 100 µg/ml | 2.24 ±0.423 | hours | 8064 | Rhesus monkey plasma proteases | LC-MS | Rhesus monkey plasma | in vivo | None | None | Not reported | ||
| 21903490 | 2011 | cTP6( Cyclic thymic hexapeptide) | 6 | Free | Free | Cyclic (Amide bond between C1-Y6) | L | None | Synthetic analog of TP5(Thymopentin) | Immunomodulatory drug | Blood collected after 5 minutes-8 hours after peptide delivery | 200 µg/ml | 2.95 ±0.157 | hours | 10620 | Rhesus monkey plasma proteases | LC-MS | Rhesus monkey plasma | in vivo | None | None | Not reported | ||
| 21903490 | 2011 | cTP6( Cyclic thymic hexapeptide) | 6 | Free | Free | Cyclic (Amide bond between C1-Y6) | L | None | Synthetic analog of TP5(Thymopentin) | Immunomodulatory drug | Blood collected after 5 minutes-8 hours after peptide delivery | 300 µg/ml | 2.56 ±0.27 | hours | 9216 | Rhesus monkey plasma proteases | LC-MS | Rhesus monkey plasma | in vivo | None | None | Not reported | ||
| 24874704 | 2014 | PEGylated AM | 52 | Pegylation | Amidation | Cyclic (Ringed structure formed by C16-C21) | L | None | Isolated from Human pheochromocytoma | Vasodilator and cardiovascular protection | Not mentioned | 3nmol/kg Dose | 108 ±12 min (2nd plasma half life) | minutes | 6480 | Rat plasma proteases | ELISA | Male Wistar rats plasma | in vivo | http://www.genscript.com/peptide/RP11288-Adrenomed | None | PEGylated AM peptide elevated intracellular cAMP levels in a dose-dependent manner with pEC50 and Emax values of 8.519 ± 0.10 and9.44 ± 0.30 nmol/well | ||
| 25453979 | 2014 | MA(D-Leu-4)OB3 | 7 | Myristoylation | Free | Linear | Mix | None | Synthetic peptide amide with leptin-like activity | Regulate energy balance by inhibiting hunger | Not mentioned | Peptide was dissolved in sterile phosphate buffered saline(PBS, pH 7.2) at a concentration of 0.1 mg | 2 | hours | 7200 | Mice serum proteases | Competitive ELISA | Male Swiss Webster mice serum(Subcutaneous Route of delivery) | in vivo | None | None | Efficacy of MA-[D-Leu-4]-OB3 on blood glucose levels in db/dbmice following oral delivery in 0.3% DDM | ||
| 25453979 | 2014 | MA(D-Leu-4)OB3 | 7 | Myristoylation | Free | Linear | Mix | None | Synthetic peptide amide with leptin-like activity | Regulate energy balance by inhibiting hunger | Not mentioned | Peptide was dissolved in sterile phosphate buffered saline(PBS, pH 7.2) at a concentration of 0.1 mg | 4.5 | hours | 16200 | Mice serum proteases | Competitive ELISA | Male Swiss Webster mice serum (Intraperitoneal route of delivery) | in vivo | None | None | Efficacy of MA-[D-Leu-4]-OB3 on blood glucose levels in db/dbmice following oral delivery in 0.3% DDM | ||
| 1329046 | 1992 | [N Psi P]BN(6-14) [Bombesin antagonist] | 9 | Free | Amidation | Linear | Mix | D-Nal =Napthylalanine | Bombesin analogue | Growth inhibitors | 0-1080 minutes | 50μM | 197 | minutes | 11820 | Degradative enzymes or SCLC cell line proteases | RP-HPLC | SCLC cell line NCI-H345 | in vitro | None | None | IC50= 5nM, Peptide were added at a 1 μM dose to inhibit growth of SCLC cell line | ||
| 1329046 | 1992 | [P Psi C]BN(6-14) [Bombesin antagonist] | 9 | Free | Amidation | Linear | Mix | Cpa=Chlorophenylalanine | Bombesin analogue | Growth inhibitors | 0-360 minutes | 50μM | 154 | minutes | 9240 | Degradative enzymes or SCLC cell line proteases | RP-HPLC | SCLC cell line NCI-H345 | in vitro | None | None | IC50= 10nM, Peptide were added at a 1 μM dose to inhibit growth of SCLC cell line | ||
| 1346149 | 1992 | SS-28 (Somatostatin-28) | 28 | Free | Free | Cyclic (C17-C28) | L | None | Hormone produced by neuroendocrine neurons of the ventromedial nucleus of the hypothalamus. | Inhibitor of growth hormone release | 37 °C for 30-180 minutes | 50μM | 228.1 ±76.5 (Metabolic half life) | minutes | 13686 | Brodmann Area tissues proteases | Radioimmunoassay | Brodmann Area tissues of brain of SDAT(Alzheimer's Disease Brain Bank, Bronx, NY) | in vitro | None | None | Not reported | ||
| 1346149 | 1992 | SS-28 (Somatostatin-28) | 28 | Free | Free | Cyclic (C17-C28) | L | None | Hormone produced by neuroendocrine neurons of the ventromedial nucleus of the hypothalamus. | Inhibitor of growth hormone release | 37 °C for 30-180 minutes | 50μM | 257.81 ±86.2(Metabolic half life) | minutes | 15468.6 | Brodmann Area tissues proteases | Radioimmunoassay | Brodmann Area tissues of brain of SDAT(Medical Research Council Brain Bank, Cambridge, England) | in vitro | None | None | Not reported | ||
| 1346149 | 1992 | SS-28 (Somatostatin-28) | 28 | Free | Free | Cyclic (C17-C28) | L | None | Hormone produced by neuroendocrine neurons of the ventromedial nucleus of the hypothalamus. | Inhibitor of growth hormone release | 37 °C for 30-180 minutes | 50μM | 260.4 ±129.8 (Metabolic half life) | minutes | 15624 | Hippucampal tissues proteases | Radioimmunoassay | Hippocampus tissues of brain of SDAT(Alzheimer's Disease Brain Bank, Bronx, NY) | in vitro | None | None | Not reported | ||
| 1346149 | 1992 | SS-14 (Somatostatin-14) | 14 | Free | Free | Cyclic (C3-C14) | L | None | Hormone produced by neuroendocrine neurons of the ventromedial nucleus of the hypothalamus. | Inhibitor of growth hormone release | 37 °C for 30-180 minutes | 50μM | 140.1 ±36.5 (Metabolic half life) | minutes | 8406 | Brodmann Area tissues proteases | Radioimmunoassay | Brodmann Area tissues of brain of SDAT(Alzheimer's Disease Brain Bank, Bronx, NY) | in vitro | None | None | Not reported | ||
| 1346149 | 1992 | SS-14 (Somatostatin-14) | 14 | Free | Free | Cyclic (C3-C14) | L | None | Hormone produced by neuroendocrine neurons of the ventromedial nucleus of the hypothalamus. | Inhibitor of growth hormone release | 37 °C for 30-180 minutes | 50μM | 129.8 ±53.2(Metabolic half life) | minutes | 7788 | Hippucampul tissues proteases | Radioimmunoassay | Hippucampus tissues of brain of SDAT(Alzheimer's Disease Brain Bank, Bronx, NY) | in vitro | None | None | Not reported | ||
| 1346149 | 1992 | SS-14 (Somatostatin-14) | 14 | Free | Free | Cyclic (C3-C14) | L | None | Hormone produced by neuroendocrine neurons of the ventromedial nucleus of the hypothalamus. | Inhibitor of growth hormone release | 37 °C for 30-180 minutes | 50μM | 79.8 ±11.1(Metabolic half life) | minutes | 4788 | Hippucampul tissues proteases | Radioimmunoassay | Posterior Hippucampus tissues of brain of SDAT(Alzheimer's Disease Brain Bank, Bronx, NY) | in vitro | None | None | Not reported | ||
| 1723638 | 1991 | Galanin(1-29) | 29 | Free | Amidation | Linear | L | None | Neuropeptide | Neuroendocrine activities, stimulates growth hormone secretion | 37 °C | 1 μM | 100 | minutes | 6000 | Hypothalamic membrane protaeses | HPLC | Hypothalamic membranes of Male Sprague-Dawley rats | in vitro | None | None | Not reported | ||
| 1826667 | 1991 | [Asp8,Ala15]Cyclo(Asp8-Lys12)GRF(1-29)-NH2 | 29 | Free | Amidation | Linear | L | None | Synthetic(GRF-1 analogs) | Release growth hormone | Not mentioned | 100 µg/ml | ~ 4 | hours | 14400 | Porcine plasma proteases | HPLC | Porcine plasma | in vitro | None | None | Not reported | ||
| 1826667 | 1991 | [D-Ala2,Asp8,Ala15]Cyclo(Asp8-Lys12)GRF(1-29)-NH2 | 29 | Free | Amidation | Linear | Mix | Cyclo-Asp at 8th position, cyclo-Lys at 12 position | Synthetic(GRF-1 analogs) | Release growth hormone | Not mentioned | 100 µg/ml | >4 | hours | 14400 | Porcine plasma proteases | HPLC | Porcine plasma | in vitro | None | None | Not reported | ||
| 1826667 | 1991 | [Ala15 ]Cyclo(Lys21 -Asp 25)GRF(1 -29)-NH2 | 29 | Free | Amidation | Linear | L | None | Synthetic(GRF-1 analogs) | Release growth hormone | Not mentioned | 100 µg/ml | >4 | hours | 14400 | Porcine plasma proteases | HPLC | Porcine plasma | in vitro | None | None | Not reported | ||
| 1826667 | 1991 | [D-Ala2,Ala15]Cyclo(Lys21-Asp25)GRF(1-29)-NH2 | 29 | Free | Amidation | Linear | Mix | None | Synthetic(GRF-1 analogs) | Release growth hormone | Not mentioned | 100 µg/ml | >4 | hours | 14400 | Porcine plasma proteases | HPLC | Porcine plasma | in vitro | None | None | Not reported | ||
| 1826667 | 1991 | [Asp8,Ala15]Cyclo(Asp8-Lys12)(Lys21-Asp25)GRF(1-29)-NH2 | 29 | Free | Amidation | Linear | L | None | Synthetic(GRF-1 analogs) | Release growth hormone | Not mentioned | 100 µg/ml | >4 | hours | 14400 | Porcine plasma proteases | HPLC | Porcine plasma | in vitro | None | None | Not reported | ||
| 1889124 | 1991 | CCK58 (Cholecystokinin 58) | 58 | Free | Amidation | Linear | L | None | Peptide hormone of the gastrointestinal system | Stimulates digestion of fat & protein | 37 °C for 30-180 minutes | 1.6pmol | 69 ±8 | minutes | 4140 | Normal Human blood proteases | Radioimmunoassay and HPLC | Normal Human blood | in vitro | None | None | Not reported | ||
| 2940625 | 1986 | [D-Trp6]-LHRH (Luteinizing hormone-releasing hormone) | 10 | Free | Amidation | Linear | Mix | Pyr=Pyro-glutamic acid | LHRH (Luteinizing hormone-releasing hormone) derivative | Release Luteinizing hormone | Blood collected 1-240 minutes after peptide infused | 100 µg/ml | >84 (beta t1/2) | minutes | 5040 | Dog plasma proteases | HPLC | Two male Beagle dogs plasma (Dose s/c injected) | in vivo | None | None | Not reported | ||
| 2970910 | 1988 | Naferlin | 10 | Free | Amidation | Linear | L | pE=Pyro-glutamate, D-alanin= 3-(2Naphthyl)-D-alanine | GnRH (Gonadotropin releasing hormone) agonist | It decreases pituitary secretion of the gonadotropins | Not mentioned | 400 µg | 2.3 ±0.2 | hours | 8280 | Human serum proteases | Radioimmunoassay | Subcutaneous route of injection in human serum | in vivo | None | None | Not reported | ||
| 2970910 | 1988 | Naferlin | 10 | Free | Amidation | Linear | L | pE=Pyro-glutamate, D-alanin= 3-(2Naphthyl)-D-alanine | GnRH (Gonadotropin releasing hormone) agonist | It decreases pituitary secretion of the gonadotropins | Not mentioned | 304 ± 2.2 µg | 2.7 ±0.2 | hours | 9720 | Human serum proteases | Radioimmunoassay | Nasal route of injection in human serum | in vivo | None | None | Not reported | ||
| 3360050 | 1988 | BW443 (Enkephalin Analogue) | 5 | Free | Amidation | Linear | Mix | 4 nitro groups linked to Phenylalanine (phe) at 4th position | Enkephalin analogue | Antinociceptive and antitussive | Blood collected 10 minutes to 8 hours after peptide infusion | 0.1-10 µg/kg peptide | 2.0 ±0.4 | hours | 7200 | Proteases from Human plasma | Radioimmunoassay | Human plasma | in vivo | None | None | Not reported | ||
| 1777964 | 1991 | CLAP(Prpcolipase activation peptide) | 5 | Free | Free | Linear | L | None | Derived from colipase | Procolipase activation peptide | Room Temperature(25C) | 0.5 µM | 4 | hours | 14400 | Proteases from Human urine | ELISA | Human urine | in vitro | None | None | Not reported | ||
| 2454805 | 1988 | [125I]IGF-I | 70 | Free | Free | Linear | L | None | Human Recombinant peptide | Stmulates glycogen synthesis | Blood collected 10 minutes to 6 hours after peptide injection | 1 µCi peptide injected to rhesus monkey | 100 | minutes | 6000 | Proteases from Rat serum | Radioimmunoassay | Rat Serum | in vivo | None | None | Stimulates glycogen synthesis by the incorporation of [14C]glucose into glycogen in rat diaphragm | ||
| 2498387 | 1989 | Buserelin | 9 | Free | Ethylamide | Linear | Mix | D-Ser(tBu) at 6th position | Analogue of LHRH (Luteinizing hormone-releasing hormone) | Stimulates release of LH, FSH and estradiol | Blood collected 0-6 hours after peptide injection | 500 µg/kg | 82.7 (elimination t1/2 after 120-360 mins of i/v injection) | minutes | 4962 | Proteases from serum of women with endometriosis | Radioimmunoassay, HPLC | (Dose i/v injected)Serum of women with endometriosis | in vivo | None | None | Serum LH, FSH, and estradiol concentrations increased acutely up to 10-fold above basal values | ||
| 2521208 | 1989 | VP (Vasopressin) | 9 | Free | Amidation | Cyclic (C1-C6) | L | None | Anti-diuretic hormone secreted by pitutiary gland | Anti-diuretic and regulates retention of water | Not mentioned | 500 µg/kg | 80 (elimination t1/2 after 6-24h of i/v injection) | minutes | 4800 | Proteases from urine of women with endometriosis | Radioimmunoassay, HPLC | (Dose i/v injected)urine of women with endometriosis | in vivo | None | None | Not mentioned | ||
| 2687064 | 1989 | Sandostatinor SMS 201-995 | 8 | Free | OL | Cyclic (C2-C7) | Mix | None | Analogue of somatostatin | Inhibitor of Growth hormone secretion | Blood collected 12hours after peptide injection | 50 µg | 144 ±15 | minutes | 8640 | Proteases from Human plasma (type 1 diabetic patients) | Radioimmunoassay | (Dose s/c injected)Human plasma (type 1diabetic patients) | in vivo | None | None | Plasma glucagon and growth hormone levels were significantly reduced after SMS 201-995 | ||
| 2524034 | 1989 | DE-gamma-E (Des-enkephalin-gamma-endorphin) | 18 | Free | Free | Linear | L | None | Neuroleptic peptide | Neuroregulator | Not mentioned | Peptide 0.04 w/v in 154mM KCl + 0.25% w/v Na2EDTA co-administeration | 93 ±45 | minutes | 5580 | Proteases from rat rectal proteases | HPLC | Rat rectal lumen | in vitro | None | None | Not mentioned | ||
| 2556215 | 1989 | Angiotensin I (AI) | 10 | Free | Free | Linear | L | None | Derived from angiotensin | Precusor of angiotensin- II (AII) | 37 °C | 100 - 2000 ng/ml | 4 | hours | 14400 | Fetal calf serum proteases | Radioimmunoassay | Primary endothelial cells + Fetal calf Serum (5%) | in vitro | None | None | Not mentioned | ||
| 2556215 | 1989 | Angiotensin I (AI) | 10 | Free | Free | Linear | L | None | Derived from angiotensin | Precusor of angiotensin- II (AII) | 37 °C | 100 - 2000 ng/ml | 1.9 | hours | 6840 | Fetal calf serum proteases | Radioimmunoassay | Primary endothelial cells + Fetal calf Serum (10%) | in vitro | None | None | Not mentioned | ||
| 2556215 | 1989 | Angiotensin I (AI) | 10 | Free | Free | Linear | L | None | Derived from angiotensin | Precusor of angiotensin- II (AII) | 37 °C | 100 - 2000 ng/ml | 4 | hours | 14400 | Fetal calf serum proteases | Radioimmunoassay | Primary endothelial cells + Fetal calf Serum(10%) + converting enzyme inhibitor (MK422) with conc 10-6 M | in vitro | None | None | Not mentioned | ||
| 2556215 | 1989 | Angiotensin I (AI) | 10 | Free | Free | Linear | L | None | Derived from angiotensin | Precusor of angiotensin- II (AII) | 37 °C | 100 - 2000 ng/ml | 1.2 | hours | 4320 | Fetal calf serum proteases | Radioimmunoassay | Primary endothelial cells + Fetal calf Serum (20%) + converting enzyme inhibitor (MK422) with conc 10-6 M | in vitro | None | None | Not mentioned | ||
| 8217216 | 1993 | AcSDKP (Acetyl-SDKP) | 4 | Acetylation | Free | Linear | L | None | Isolated from fetal calf bone marrow | Natural hemoregulatory | 37 °C for 24 hours | 4 X lO-7M, 10 µCi | 1.3 | hours | 4680 | Proteases from Human plasma | HPLC | Human plasma | in vitro | None | None | Not reported | ||
| 8217216 | 1993 | AcSDKP (Acetyl-SDKP) | 4 | Acetylation | Free | Linear | L | None | Isolated from fetal calf bone marrow | Natural hemoregulatory | 37 °C for 24 hours | 4 X lO-7M, 10 µCi | 1.7 | hours | 6120 | Proteases from Human blood | HPLC | Human blood | in vitro | None | None | Not reported | ||
| 8217216 | 1993 | AcSDKP (Acetyl-SDKP) | 4 | Acetylation | Free | Linear | L | None | Isolated from fetal calf bone marrow | Natural hemoregulatory | 37 °C for 24 hours | 4 X lO-7M, 10 µCi | 3.5 | hours | 12600 | Proteases from Fetal calf serum | HPLC | Fetal calf serum | in vitro | None | None | Not reported | ||
| 8217216 | 1993 | AcSDKP (Acetyl-SDKP) | 4 | Acetylation | Free | Linear | L | None | Isolated from fetal calf bone marrow | Natural hemoregulatory | 37 °C for 24 hours | 4 X lO-7M, 10 µCi | 1.75 | hours | 6300 | Proteases from Heat inactivated calf serum | HPLC | Heat inactivated calf serum | in vitro | None | None | Not reported | ||
| 8217216 | 1993 | AcSDKP (Acetyl-SDKP) | 4 | Acetylation | Free | Linear | L | None | Isolated from fetal calf bone marrow | Natural hemoregulatory | 37 °C for 24 hours | 4 X lO-7M, 10 µCi | 4 | hours | 14400 | Proteases from Mouse serum | HPLC | Mouse serum | in vitro | None | None | Not reported | ||
| 8218482 | 1993 | Pentapeptide | 5 | Free | Free | Linear | L | None | Synthetic RGD containing peptide | Cell attachment property | Not mentioned | Not mentioned | 2.7 (Half life of 2nd phase) | hours | 9720 | Proteases from mouse bood | HPLC | Mouse blood | in vivo | None | None | Not reported | ||
| 8289671 | 1994 | Octreotide | 8 | Free | Free | Cyclic (C2-C7) | Mix | None | Somatostatin analogue | Inhibitor of growth hormone secretion | Blood sample collected after 15-60 minutes | 500 µg/ml | 90 | minutes | 5400 | Proteases from Human plasma | Not mentioned | Human plasma | in vivo | None | None | 30ng/kg/min of peptide suppress C-peptide, Insulin, glucagon and growth hormone conc. Below basal level in islet cell clamp study | ||
| 8353526 | 1993 | TMOF (Trypsin modulatinf oostatic factor) | 10 | Free | Free | Linear | L | None | Hormone is secreted from the ovary of Mosquitoes | Inhibitor of trypsin and chymotrypsin biosynthesis | Not mentioned | 30ng/group | 1.6 | hours | 5760 | Proteases from A. aegypti blood | RP-HPLC | A. aegypti blood | in vivo | None | None | Not reported | ||
| 8403527 | 1993 | CGRP(Calcitonin gene related peptide) | 37 | Free | Amidation | Cyclic (C2-C7) | L | None | Neuropeptide and alernative spliced product of calcitonon produced by thyroid gland | Vasodilator | Blood sample collected after 2-90 minutes | 1.0 pmol/ml of peptide | 63.9 ±4.5 | minutes | 3834 | Rat plasma proteases and isolated perfused rat kidney | Not mentioned | Rat plasma (+IPRK (isolated perfused rat kidney)filtering) | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A(1-11)-NH2 analogue 2 (DYN A analogue) | 11 | Free | Amidation | Linear | L | None | Human placenta Dynorphin A derivative | Incorporating the nonhydrolyzable [CH2-NH] peptide bond surrogate were tested for their in vitro enzymatic stability in mouse brain homogenates. | 37 °C | 100 µM | 67 | minutes | 4020 | Proteases from mouse brain tissues | HPLC | Mouse brain homogenate | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A(1-11)-NH2 analogue 4 (DYN A analogue) | 11 | Free | Amidation | Linear | L | None | Human placenta Dynorphin A derivative | Incorporating the nonhydrolyzable [CH2-NH] peptide bond surrogate were tested for their in vitro enzymatic stability in mouse brain homogenates. | 37 °C | 100 µM | 100 | minutes | 6000 | Proteases from mouse brain tissues | HPLC | Mouse brain homogenate | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A(1-11)-NH2 analogue 6 (DYN A analogue) | 11 | Free | Amidation | Linear | L | None | Human placenta Dynorphin A derivative | Incorporating the nonhydrolyzable [CH2-NH] peptide bond surrogate were tested for their in vitro enzymatic stability in mouse brain homogenates. | 37 °C | 100 µM | 80 | minutes | 4800 | Proteases from mouse brain tissues | HPLC | Mouse brain homogenate | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A(1-11)-NH2 analogue 7 (DYN A analogue) | 11 | Free | Amidation | Linear | L | None | Human placenta Dynorphin A derivative | Incorporating the nonhydrolyzable [CH2-NH] peptide bond surrogate were tested for their in vitro enzymatic stability in mouse brain homogenates. | 37 °C | 100 µM | 192 | minutes | 11520 | Proteases from mouse brain tissues | HPLC | Mouse brain homogenate | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A(1-11)-NH2 analogue 8 (DYN A analogue) | 11 | Free | Amidation | Linear | L | None | Human placenta Dynorphin A derivative | Incorporating the nonhydrolyzable [CH2-NH] peptide bond surrogate were tested for their in vitro enzymatic stability in mouse brain homogenates. | 37 °C | 100 µM | 191 | minutes | 11460 | Proteases from mouse brain tissues | HPLC | Mouse brain homogenate | in vitro | None | None | Not reported | ||
| 8545241 | 1995 | Dynorphin A(1-11)-NH2 analogue 9 (DYN A analogue) | 11 | Free | Amidation | Linear | L | None | Human placenta Dynorphin A derivative | Incorporating the nonhydrolyzable [CH2-NH] peptide bond surrogate were tested for their in vitro enzymatic stability in mouse brain homogenates. | 37 °C | 100 µM | 93 | minutes | 5580 | Proteases from mouse brain tissues | HPLC | Mouse brain homogenate | in vitro | None | None | Not reported | ||
| 8545255 | 1995 | Hexarelin | 6 | Free | Amidation | Linear | Mix | None | GHRH analogue | Stimulates growth hormone release | Blood sample collected after 0.5-300 minutes | 1 µg/kg | 120 | minutes | 7200 | Proteases from dog plasma | Radioimmunoassay | (Dose i/v injected)Dog plasma | in vivo | None | None | Not reported | ||
| 8395230 | 1993 | Bradykinin | 9 | Free | Free | Linear | L | None | Endogenous peptide of kinin family | Vasodilator, Inflammatory mediator | 37 °C for 15-240 minutes | 10 µg/L of peptide | 244 ±20 | minutes | 14640 | Neutral endopeptides in Human umbilical vein endothelial cells | Radioimmunoassay | Human umbilical vein endithelial cells+ Lisinopril | in vitro | None | None | Not reported | ||
| 8395230 | 1993 | Bradykinin | 9 | Free | Free | Linear | L | None | Endogenous peptide of kinin family | Vasodilator, Inflammatory mediator | 37 °C for 15-240 minutes | 10 µg/L of peptide | 257 ±22 | minutes | 15420 | Neutral endopeptides in Human umbilical vein endothelial cells | Radioimmunoassay | Human umbilical vein endithelial cells + Lisinopril +phosphoramidon+amastain + DL-2-mercaptomethyl- 3-guanidinoethyl thiopropionic acid | in vitro | None | None | Not reported | ||
| 18424366 | 2008 | GLP(7-34) (Glucagon like peptide) | 28 | Acetylation | Amidation | Linear | L | None | GLP-1 (Glucagon like peptide-1) analogue | Antihyperglycemic or incretin effect (Stimulate Insulin release in glucose dependent manner) | 37C for 2 hours | 200 µg/ml | >2 | hours | 7200 | DPP IV | MALDI-TOF-MS | Peptide in 0.01 M Na2HPO4 buffer | in vitro | None | None | In the DPP-IV-free rat pancreatic beta cell line RINm5F GLP-1-(7-34)-amide elevated cAMP production with an EC50 of about 40 nM | ||
| 24361089 | 2014 | Teriparatide | 34 | Free | Free | Linear | L | None | Parathyroid Hormone derivative | Increase the concentration of ionic calcium (Ca2+) in the blood | Not mentioned | Not available | 5 (Elimination half life) | hours | 18000 | Proteases from human plasma(Severe renal impairment patients) | Not mentioned | Human plasma (Severe renal impairment patients) | in vivo | None | None | Not reported | ||
| 24361089 | 2014 | Teriparatide | 34 | Free | Free | Linear | L | None | Parathyroid Hormone derivative | Increase the concentration of ionic calcium (Ca2+) in the blood | Not mentioned | Not available | 1.5 (Elimination half life) | hours | 5400 | Proteases from human plasma(Normal) | Not mentioned | Human plasma (Normal) | in vivo | None | None | Not reported | ||
| 7994807 | 1994 | Prothrombin fragment 1.2 | 273 | Free | Free | Linear | L | None | Prothrombin | Not mentioned | Not reported | Not reported | 90 | minutes | 5400 | Human blood proteases in presence of Hirudin (anti-coagulant) | Radioimmunoassay ,ELISA | Human blood plasma sample | in vivo | 3759958, 2824564 | None | Not mentioned | ||
| 12083977 | 2002 | Leuprorelin | 9 | 5-oxo | Ethylacetate | Linear | Mix | None | Synthetic agonist analogue of gonadotropin-releasing hormone | Suppression of gonadal steroid synthesis, resulting in pharmacological castration | Not mentioned | 1mg | 2.9 ±60.5(t1/2β) | hours | 10440 | Diestrous female rats blood proteases | Radioimmunoassay | Intravenous injection in 6 healthy humans serum | in vivo | None | None | Not mentioned | ||
| 12083977 | 2002 | Leuprorelin | 9 | 5-oxo | Ethylacetate | Linear | Mix | None | Synthetic agonist analogue of gonadotropin-releasing hormone | Suppression of gonadal steroid synthesis, resulting in pharmacological castration | Not mentioned | 1mg | 3.6 ±1.2(t1/2β) | hours | 12960 | Diestrous female rats blood proteases | Radioimmunoassay | Subcutaneous injection in 6 healthy humans serum | in vivo | None | None | Not mentioned | ||
| 15656696 | 2005 | Enfuvirtide | 36 | Acetylation | Amidation | Linear | L | None | Synthetic peptide derived from the naturally occurring motif (residues 643 €“678) within the second heptad repeat (HR2) domain of the HIV- 1HXB2 gp41 transmembrane glycoprotein. | Inhibits de novo infection and cell-to-cell HIV-1 virus transmission | Not mentioned | 90mg | 3.16(t1/2β) | hours | 11376 | Human blood proteases | liquid chromatography-tandem mass spectrometry method | Intravenous injection in 12 HIV patients,blood samples | in vivo | http://www.drugbank.ca/drugs/DB00109 | None | Not mentioned | ||
| 15656696 | 2005 | Enfuvirtide | 36 | Acetylation | Amidation | Linear | L | None | Synthetic peptide derived from the naturally occurring motif (residues 643 €“678) within the second heptad repeat (HR2) domain of the HIV- 1HXB2 gp41 transmembrane glycoprotein. | Inhibits de novo infection and cell-to-cell HIV-1 virus transmission | Not mentioned | 45mg | 3.46(t1/2β) | hours | 12456 | Human blood proteases | liquid chromatography-tandem mass spectrometry method | Subcutaneous injection in 12 HIV patients,blood samples | in vivo | http://www.drugbank.ca/drugs/DB00109 | None | Not mentioned | ||
| 15656696 | 2005 | Enfuvirtide | 36 | Acetylation | Amidation | Linear | L | None | Synthetic peptide derived from the naturally occurring motif (residues 643 €“678) within the second heptad repeat (HR2) domain of the HIV- 1HXB2 gp41 transmembrane glycoprotein. | Inhibits de novo infection and cell-to-cell HIV-1 virus transmission | Not mentioned | 90mg | 3.8(t1/2β) | hours | 13680 | Human blood proteases | liquid chromatography-tandem mass spectrometry method | Subcutaneous injection in 12 HIV patients,blood samples | in vivo | http://www.drugbank.ca/drugs/DB00109 | None | Not mentioned | ||
| 15656696 | 2005 | Enfuvirtide | 36 | Acetylation | Amidation | Linear | L | None | Synthetic peptide derived from the naturally occurring motif (residues 643 €“678) within the second heptad repeat (HR2) domain of the HIV- 1HXB2 gp41 transmembrane glycoprotein. | Inhibits de novo infection and cell-to-cell HIV-1 virus transmission | Not mentioned | 180mg | 4.35(t1/2β) | hours | 15660 | Human blood proteases | liquid chromatography-tandem mass spectrometry method | Subcutaneous injection in 12 HIV patients,blood samples | in vivo | http://www.drugbank.ca/drugs/DB00109 | None | Not mentioned | ||
| 19023544 | 2008 | Tα1-TP5 (Thymosin α1-thymopentin) | 33 | Acetylation | Free | Linear | L | None | Synthetic | Immunoregulatory | Not mentioned | Not mentioned | 140 ±14 | minutes | 8400 | Rabbit plasma proteases | HPLC | Heparinized rabbit plasma | in vitro | http://www.drugbank.ca/drugs/DB00110 | None | IL2 concentration in mouse serum:0.75pg/ml,macrophage clearance index(K value)=0.0206 ±0.0010,phagocytic index(α value=3.95 ±0.19(compared to TP5). | ||
| 19023544 | 2008 | Tα1 (Thymosin α1) | 28 | Acetylation | Free | Linear | L | None | Component of thymosin fraction | Immunomodulator | Not mentioned | Not mentioned | 127 ±11 | minutes | 7620 | Rabbit plasma proteases | HPLC | Heparinized rabbit plasma | in vitro | http://www.drugbank.ca/drugs/DB00111 | None | IL2 concentration in mouse serum:0.7pg/ml,macrophage clearance index(K value)=0.0165 ±0.0007,phagocytic index(α value=3.73 ±0.56. | ||
| 20687610 | 2010 | GLP-1 (glucagon like peptide-1) | 30 | Free | Free | Linear | L | None | Incretin released by intestinal L cells | Glucose dependent insulin secretion,promotion of insulin gene transcription,stimulation of β-cell proliferation and neogenesis, inhibition of β-cell apoptosis, and suppression of glucagon secretion. | 24 hours | 100μM | 2.0 ±0.2 | hours | 7200 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00115 | None | EC50=4.6nM,pEC50=8.3 ±0.08 | ||
| 20687610 | 2010 | c[E16,K20]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16 and K20) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 1.8 ±0.3 | hours | 6480 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00116 | None | EC50=3.8nM,pEC50=8.4 ±0.06 | ||
| 20687610 | 2010 | c[E18,K22]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E18 and K22) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 2.1 ±0.4 | hours | 7560 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00117 | None | EC50=0.6nM,pEC50=9.2 ±0.11 | ||
| 20687610 | 2010 | c[E22,K26]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E22 and K26) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 2.9 ±0.8 | hours | 10440 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00118 | None | EC50=2.8nM,pEC50=8.3 ±0.03 | ||
| 20687610 | 2010 | c[E30,K34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E30 and K34) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 3.3 ±0.4 | hours | 11880 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00119 | None | EC50=5.3nM,pEC50=8.6 ±0.13 | ||
| 20687610 | 2010 | c[E16,K20]-c[E30,K34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16-K20 and E30-K34) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 3.1 ±0.1 | hours | 11160 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00120 | None | EC50=3.3nM,pEC50=8.5 ±0.04 | ||
| 20687610 | 2010 | c[K16,E20]-c[K30,E34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between K16-E20 and K30-E34) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 2.9 ±0.1 | hours | 10440 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00121 | None | EC50=7.0nM,pEC50=8.2 ±0.11 | ||
| 20687610 | 2010 | c[E18,K22]-c[E30,K34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E18-K22 and E30-K34) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 3.6 ±0.2 | hours | 12960 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00122 | None | EC50=1.9nM,pEC50=8.7 ±0.14 | ||
| 20687610 | 2010 | c[K18,E22]-c[K30,E34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between K18-E22 and K30-E34) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 4.1 ±0.2 | hours | 14760 | Dipeptidyl peptidase-IV | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00123 | None | EC50=1.0nM,pEC50=9.0 ±0.09 | ||
| 20687610 | 2010 | c[E16,K20]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16-K20, E22-K26 and E30-K35) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 4.6 ±0.7 | hours | 16560 | Neutral endopeptidase 24.11 | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human DPP-IV enzyme (0.2 ng/mL) in Tris buffer (25 mM, pH 8.0) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00127 | None | EC50=3.8nM,pEC50=8.4 ±0.06 | ||
| 20687610 | 2010 | c[E18,K22]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16-K20, E22-K26 and E30-K36) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 3.2 ±0.4 | hours | 11520 | Neutral endopeptidase 24.11 | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human NEP 24.11 enzyme (1.0 μg/mL) in HEPES buffer (50 mM, pH 7.4, 50 mM NaCl) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00128 | None | EC50=0.6nM,pEC50=9.2 ±0.11 | ||
| 20687610 | 2010 | c[K16,E20]-c[K30,E34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16-K20, E22-K26 and E30-K40) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 1.7 ±5.0 | hours | 6120 | Neutral endopeptidase 24.11 | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human NEP 24.11 enzyme (1.0 μg/mL) in HEPES buffer (50 mM, pH 7.4, 50 mM NaCl) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00132 | None | EC50=7.0nM,pEC50=8.2 ±0.11 | ||
| 20687610 | 2010 | c[E22,K26]-c[E30,K34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16-K20, E22-K26 and E30-K43) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 3.5 ±0.9 | hours | 12600 | Neutral endopeptidase 24.11 | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human NEP 24.11 enzyme (1.0 μg/mL) in HEPES buffer (50 mM, pH 7.4, 50 mM NaCl) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00135 | None | EC50=1.6nM,pEC50=8.8 ±0.11 | ||
| 20687610 | 2010 | c[K22,E26]-c[K30,E34]GLP-1(7-36)-NH2 | 30 | Free | Amidation | Cyclic (Lactam bridge between E16-K20, E22-K26 and E30-K44) | L | None | Analog of GLP-1 | Diagnosis and treatment of diabetes | 24 hours | 100μM | 1.2 ±0.3 | hours | 4320 | Neutral endopeptidase 24.11 | HPLC | GLP-1 analogue (100 μM) was incubated with the recombinant human NEP 24.11 enzyme (1.0 μg/mL) in HEPES buffer (50 mM, pH 7.4, 50 mM NaCl) at 37 °C | in vitro | http://www.drugbank.ca/drugs/DB00136 | None | EC50=2.2nM,pEC50=8.7 ±0.14 | ||
| 22770564 | 2012 | N-terminus-PEG2000 of HR2 | 42 | Pegylation-PEG2000 | Free | Linear | L | None | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 79.3 | minutes | 4758 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00148 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=11.2 ± 1.9nM | ||
| 22770564 | 2012 | R4C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at 4th position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 67.4 | minutes | 4044 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00151 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=8.7 ± 1.3nM | ||
| 22770564 | 2012 | S11C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at 11th position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 91 | minutes | 5460 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00154 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=4.9 ± 0.5nM | ||
| 22770564 | 2012 | S15C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at 15th position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 82.4 | minutes | 4944 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00157 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=5.0 ± 0.5nM | ||
| 22770564 | 2012 | E18C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at 18th position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 81.3 | minutes | 4878 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00160 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=4.9 ± 0.6nM | ||
| 22770564 | 2012 | N22C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at22nd position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 80.7 | minutes | 4842 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00163 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=5.1 ± 0.5nM | ||
| 22770564 | 2012 | Q29C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at 29th position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 84.1 | minutes | 5046 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00166 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=5.5 ± 0.5nM | ||
| 22770564 | 2012 | C terminus-PEG750 derivative of HR2 | 42 | Free | Free | Linear | L | None | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 81.2 | minutes | 4872 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00168 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=10.9 ± 2.2nM | ||
| 22770564 | 2012 | C terminus-PEG2000 derivative of HR2 | 42 | Free | Pegylation (PEG750) | Linear | L | None | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 126 | minutes | 7560 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00169 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)=43.3 ± 14.8nM | ||
| 22770564 | 2012 | S20C-PEG2000 derivative of HR2 | 41 | Free | Free | Linear | L | Pegylation-PEG2000 of cysteine at 20th position | Modified HR2 wild type peptide | Inhibitor to prevent virus ˆ’host cell membrane fusion | Not mentioned | 20μM | 76.3 | minutes | 4578 | Bovine Trypsin | Trypsin degradation assay, Analytical reverse phase HPLC | Solutions of bovine trypsin and the peptide or PEG ˆ’peptide conjugate in 10 mM PBS (pH 7.4) | in vitro | http://www.drugbank.ca/drugs/DB00172 | None | Cell ˆ’Cell Fusion Inhibition Efficacy (IC50)>401 | ||
| 23099431 | 2012 | GHRP-6 (Growth Hormone-Releasing Peptide-6) | 7 | Free | Amidation | Linear | Mix | None | Synthetic molecule structurally related to Met-enkephalin | Cytoprotective,antioxidant in nature | Not mentioned | 100 μg/kg of the body weight | 2.96 ±1.12(t1/2β) | hours | 10656 | human plasma proteases | LC-MS | Intravenous bolus administartion in 9 healthy male subjects | in vivo | http://www.drugbank.ca/drugs/DB00174 | None | Not mentioned | ||
| 23099431 | 2012 | GHRP-6 (Growth Hormone-Releasing Peptide-6) | 9 | Free | Amidation | Linear | Mix | None | Synthetic molecule structurally related to Met-enkephalin | Cytoprotective,antioxidant in nature | Not mentioned | 200 μg/kg of the body weight | 3.27 ±2.07(t1/2β) | hours | 11772 | human plasma proteases | LC-MS | Intravenous bolus administartion in 9 healthy male subjects | in vivo | http://www.drugbank.ca/drugs/DB00176 | None | Not mentioned | ||
| 23099431 | 2012 | GHRP-6 (Growth Hormone-Releasing Peptide-6) | 11 | Free | Amidation | Linear | Mix | None | Synthetic molecule structurally related to Met-enkephalin | Cytoprotective,antioxidant in nature | Not mentioned | 400 μg/kg of the body weight | 1.15 ±0.17(t1/2β) | hours | 4140 | human plasma proteases | LC-MS | Intravenous bolus administartion in 9 healthy male subjects | in vivo | http://www.drugbank.ca/drugs/DB00178 | None | Not mentioned | ||
| 23696181 | 2013 | Cx43MP (Connexin43 mimetic peptides) | 12 | Free | Free | Linear | L | None | Synthetic, matching amino acids 199-210 on the extracellular loop 2 of Cx43 | Blocking Cx43 hemichannel mediated vascular leakage in case of retinal ischemia | Aliquots were collected at 0, 5, 30, 60, 120, and 240 min | 500μM | 145.57 ±14.57 | minutes | 8734.2 | Bovine vitreous proteases | RP-HPLC | 500 μL of freshly collected bovine vitreous | in vitro | http://www.drugbank.ca/drugs/DB00181 | None | Cell viability of NT2/ D1 cells at 100μM of peptide= 90% approx. after 48 hours | ||
| 19422857 | 2009 | Mouse Obestatin | 23 | Free | Amidation | Linear | L | None | Proghrelin from mouse | Energy balance, Inhibit Ghrelin-induced Growth Hormone secretion | 37 °C for 0 - 120 minutes | 90 μg | 75.5 | minutes | 4530 | Proteases from Membrane brain Homogenate | HPLC | Membrane brain Homogenate + P8340 protease inhibitor cocktail | in vitro | http://www.sigmaaldrich.com/catalog/product/sigma/ | None | No suppressive effects of obestatin on food or water intake were observed | ||
| 19422857 | 2009 | Mouse Obestatin | 23 | Free | Amidation | Linear | L | None | Proghrelin from mouse | Energy balance, Inhibit Ghrelin-induced Growth Hormone secretion | 37 °C for 0 - 120 minutes | 90 μg | 62 | minutes | 3720 | Proteases from Membrane brain Homogenate | HPLC | Membrane brain Homogenate + EDTA | in vitro | http://www.sigmaaldrich.com/catalog/product/sigma/ | None | No suppressive effects of obestatin on food or water intake were observed | ||
| 18602197 | 2008 | Mouse Obestatin | 23 | Free | Amidation | Linear | L | None | Proghrelin from mouse | Energy balance, Inhibit Ghrelin-induced Growth Hormone secretion | 37 °C for 0 - 60 minutes, pH 7.7 | 90 μg | 138.0 [114.8, 172.9] | minutes | 8280 | Proteases from Mouse kidney membrane homogenate | HPLC, LC-UV/MS | Mouse kidney membrane homogenate | in vitro | http://www.sigmaaldrich.com/catalog/product/sigma/ | None | Not reported | ||
| 18602197 | 2008 | Human Obestatin | 23 | Free | Amidation | Linear | L | None | Proghrelin frpm human | Energy balance, Inhibit Ghrelin-induced Growth Hormone secretion | 37 °C for 0 - 60 minutes, pH 7.8 | 90 μg | 65.1 [59.6, 71.7] | minutes | 3906 | Proteases from mouse plasma | HPLC, LC-UV/MS | Mouse plasma | in vitro | http://www.sigmaaldrich.com/catalog/product/sigma/ | None | Not reported | ||
| 18602197 | 2008 | Human Obestatin | 23 | Free | Amidation | Linear | L | None | Proghrelin frpm human | Energy balance, Inhibit Ghrelin-induced Growth Hormone secretion | 37 °C for 0 - 60 minutes, pH 7.9 | 90 μg | 95.8 [89.4, 103.3] | minutes | 5748 | Proteases from mouse plasma + protease inhibitor cocktai | HPLC, LC-UV/MS | Mouse plasma with protease inhibitor cocktail | in vitro | http://www.sigmaaldrich.com/catalog/product/sigma/ | None | Not reported | ||
| 18602197 | 2008 | Human Obestatin | 23 | Free | Amidation | Linear | L | None | Proghrelin frpm human | Energy balance, Inhibit Ghrelin-induced Growth Hormone secretion | 37 °C for 0 - 60 minutes, pH 7.12 | 90 μg | 67.7 [61.7, 75.1] | minutes | 4062 | Proteases from mouse membrane homogenate | HPLC, LC-UV/MS | Mouse kidney membrane homogenate | in vitro | http://www.sigmaaldrich.com/catalog/product/sigma/ | None | Not reported | ||
| 38789061 | 2024 | Exenatide | 39 | Free | Amidation | Linear | L | None | Exendin-4 analogs | Antidiabetes | Blood sample was collected for IV-dosed rats, time points were pre-dose, 1 min, 5 min, 15 min, 30 min, 1 hr, 2 hr, 4 hr, 8 hr, 10 hr, and 24 hr | 1 mg/kg | 1.03 ± 0.10 | Hours | 3708 | Male SD rats plasma protease | UHPLC | Male SD rats plasma | In Vivo | PDB id: 7MLL | None | N.A. | ||
| 38613996 | 2024 | vCPP2319 | 20 | Free | Amidation | Linear | L | None | Synthetic | Anticancer | At different time points (0, 1, 5, 10, 30, 60, 120, and 360 min), 120 µL aliquots were collected and incubated with equal volume of 96% ethanol for 30 min at 4⁰C | 1 mM | 280.40 ± 59.20 | Minutes | 16824 | Human serum protease | RP-HPLC | Human serum | In Vitro | None | None | IC50 = 4.00±1.03 for TNBC MDA-MB-231 Monolayer | ||
| 38613996 | 2024 | PepH3-vCPP2319 5 | 27 | Free | Amidation | Linear | L | Ahx links two peptide | Synthetic chimeric peptide of PepH3 and vCPP2319 | Anticancer | At different time points (0, 1, 5, 10, 30, 60, 120, and 360 min), 120 µL aliquots were collected and incubated with equal volume of 96% ethanol for 30 min at 4⁰C | 1 mM | 125.20 ± 34.21 | Minutes | 7512 | Human serum protease | RP-HPLC | Human serum | In Vitro | None | None | IC50 = 5.20±1.04 for TNBC MDA-MB-231 Monolayer | ||
| 38601038 | 2024 | DR10627 | 39 | Free | Amidation | Linear | L | A palmitoyl group is conjugated to DR10627 via a -γ-glutamyl-linker connected to the Lys10 position | GLP-1 analogs | Antiobesity, Antidiabetes | Blood samples were collected at 0 (pre-dose), 0.5, 1, 2, 4, 8, 12, 16, 20, 24, 30, 38 and 48 h after administration | 26 nmol/kg | 4.19 ± 0.957 | Hours | 15084 | Cynomolgus monkeys serum protease | LC-MS/MS | Cynomolgus monkeys serum | In Vivo | None | None | The glucose-lowering effect of 12 nmol/kg DR10627 reached its lowest point at 2 hours post-administration, and the effect lasted for 24 hours, indicating a long-lasting action | ||
| 38555444 | 2024 | Aβ11/T80@CSs-TGC | 12 | Free | Linked with Chol using PEG2k linker | Linear | L | None | Synthetic | Treating intracranial infections caused by multidrug resistant Acinetobacter Baumannii | Blood samples were collected at predetermined time points (0.25, 0.5, 1, 2, 4, 6, and 8 h), | 12.5 mg/kg | 1.26 ± 0.21 | Hours | 4536 | SD rats plasma protease | HPLC | SD rats plasma | In Vivo | None | None | Both free TGC and Aβ11/T80@CSs-TGC displayed potent antimicrobial activity with a minimum inhibitory concentration of 2 μg/mL | ||
| 38340726 | 2024 | A1L35HR2m | 114 | Conjugation of angiotensin-converting enzyme 2 (ACE2)-derived peptide A1 to the N terminus of the viral HR2-derived peptide HR2m through a long flexible linker, | Free | Linear | L | None | fusion protein of A1 and HR2m | Antiviral (Inhibits Coronaviruses) | Sera were collected from these mice before (0 h) and 2, 4, 8, 12, 24, 48, 72, 120, 168, 240 and 336 h after injection | 5 mg/kg | 2.64 | Hours | 9504 | Balb/c mice serum protease | N.A. | BALB/c mice serum | In Vivo | None | None | A1L35HR2m was highly potent in inhibiting SARS-CoV-2 infection with an IC50 value of 27 nM | ||
| 37818589 | 2024 | ΔTRTX-Ac1 | 28 | Free | Free | Cyclic (C2-C9-C18-C19-C22-C27 form LCK Loop) | L | None | From venom of the Mexican Blond tarantula spider Aphonopelma chalcodes | Antidiabetes | Blood withdrawn by cardiac puncture at0, 2, 4, 6, 8 and 12 h post-administration | 10 mg/kg | 2.17 | Hours | 7812 | C57Bl/6 Male Mice Plasma Protease | Mass spectrometry | C57BL/6 male mice plasma | In Vivo | https://dom-pubs.pericles-prod.literatumonline.com/doi/10.1111/dom.15319 | None | The activity value of ΔTRTX-Ac1 alone shows minimal influence on reducing circulating glucose levels, with glucose levels remaining at 23.7 ± 3.1 mmol/L in high-fat-fed/streptozotocin (HFF/STZ) mice | ||
| 37818589 | 2024 | ΔTRTX-Ac1 | 28 | Free | Free | Cyclic (C2-C9-C18-C19-C22-C27 form LCK Loop) | L | None | From venom of the Mexican Blond tarantula spider Aphonopelma chalcodes | Antidiabetes | Blood withdrawn by cardiac puncture at 0, 2, 4, 6, 8 and 12 h post-administration | 10 mg/kg | 2.16 | Hours | 7776 | C57Bl/6 Male Mice Pancreas Protease | Mass spectrometry | C57BL/6 male mice pancreas | In Vivo | https://dom-pubs.pericles-prod.literatumonline.com/doi/10.1111/dom.15319 | None | The activity value of ΔTRTX-Ac1 alone shows minimal influence on reducing circulating glucose levels, with glucose levels remaining at 23.7 ± 3.1 mmol/L in high-fat-fed/streptozotocin (HFF/STZ) mice | ||
| 38863646 | 2024 | (89Zr, Mn)-WPMNs | None | Free | Free | Linear | L | Mn and 89Zr labeling, MNPs modified with WL12-SH | WL12 derivative | Targets PD-L1 | Blood samples were collected from orbital vein at 1, 3, 5, 10, 15, 20, 30, 45 min and 1, 1.5, 2, 3, 4, 14, 24, 48, 72, 96 h | 0.5 mg/ml | 1.554 (Slow) (Distribution Half Life) | Hours | 5594.4 | KM mouse blood protease | Radioactivity assay using γ-counter | KM mouse blood sample | In Vivo | None | None | N.A. | ||
| 38092894 | 2023 | Tag-free rhMFG-E8 | 387 | 23 amino acid leader sequence of cystatin S introduced at N terminal | Free | Linear | L | None | Expressed in Expi293F cells | Antiinflammatory (Including Radiation Injury) | Blood samples (100 μl per time point) were collected starting from 2 to 6 hours | 50 µg | 1.45 (Terminal Elimination Half Life) | Hours | 5220 | SD rats plasma protease | ELISA | SD rats plasma | In Vivo | None | None | The tag-free rhMFG-E8 demonstrated markedly higher cell adhesion binding activity (to SVEC4-10 cells) compared to E. coli-expressed His-tagged rhMFG-E8, which binds to αVβ3 integrin on the membrane of phagocytes | ||
| 38092894 | 2023 | Tag-free rhMFG-E8 | 387 | 23 amino acid leader sequence of cystatin S introduced at N terminal | Free | Linear | L | None | Expressed in Expi293F cells | Antiinflammatory (Including Radiation Injury) | Blood samples (100 μl per time point) were collected starting from 2 to 12 hours | 50 µg | 2.33 (Terminal Elimination Half Life) | Hours | 8388 | SD rats plasma protease | ELISA | SD rats plasma | In Vivo | None | None | The tag-free rhMFG-E8 demonstrated markedly higher cell adhesion binding activity (to SVEC4-10 cells) compared to E. coli-expressed His-tagged rhMFG-E8, which binds to αVβ3 integrin on the membrane of phagocytes | ||
| 38027063 | 2023 | ScFv9-CD | 466 | Free | Fusion of CD | Linear | L | Biotinylation | CD sequence originates from the C1qTNF3 protein and scFv9 sequence is derived from an antibody fragment to target amyloid beta (Aβ) | Treatment of AD and Parkinson disease | Plasma was collected at 0, 2, 4, 8, and 24 h after injection | 250 μg | 1.82 | Hours | 6552 | TgCRND8 mice plasma protease | Direct ELISA | TgCRND8 mice plasma | In Vivo | None | None | N.A. | ||
| 37880318 | 2023 | L1 | 15 | Acetylation | Free | Linear | L | None | Derived from calcitermin | Antimicrobial | 37 °C | 0.0001 M | >2 | Hours | 7200 | Human plasma protease | HPLC | Human plasma with 1 ml of ammonium acetate buffer (pH 7.4) | In Vitro | None | None | CFU = 40 ± 10 for 0.032 mg/mL peptide concentration (0.1 mL of microbial suspension after 24 hours of incubation at 37°C) (Effect of peptide derivatives on Candida albicans (ATCC 10231) proliferation) | ||
| 37880318 | 2023 | L2 | 15 | Acetylation | Amidation | Linear | L | None | Derived from calcitermin | Antimicrobial | 37 °C | 0.0001 M | 68 | Minutes | 4080 | Human plasma protease | HPLC | Human plasma with 1 ml of ammonium acetate buffer (pH 7.4) | In Vitro | None | None | CFU = 211 ± 25 for 0.032 mg/mL peptide concentration (0.1 mL of microbial suspension after 24 hours of incubation at 37°C) (Effect of peptide derivatives on Candida albicans (ATCC 10231) proliferation) | ||
| 37835489 | 2023 | QQT*-IRDye800 | 12 | QQT* conjugated with IRDye800 at C terminus using linker | Free | Linear | L | None | Synthetic | Used for in vivo imaging to identify premalignant Colorectal Lesions | RP-HPLC was performed at 0, 0.5, 1, 2, 4, 8, and 24 h | 30 μM | 3.6 | Hours | 12960 | APC mice serum protease | RP-HPLC | APC mice serum | In Vivo | None | None | Not mentioned | ||
| 37373203 | 2023 | HM-10/10 | 20 | Free | Free | Linear | L | None | Chimeric high-density lipoprotein mimetic peptide | Anticancer | Timepoints of 0, 10, 20, 30, 60, and 120 min | 2 μM | 164 | Minutes | 9840 | Human plasma protease | Triple Quadrupole Mass spectrometry | Human plasma | In Vitro | None | None | Enzyme Activity = 0.682 at 2 microMolar of HM1010 (Cytochrome P450 (CYP1A2) Induction in Single-Donor Human Hepatocytes Lot HH1086) | ||
| 37373203 | 2023 | HM-10/10 | 20 | Free | Free | Linear | L | None | Chimeric high-density lipoprotein mimetic peptide | Anticancer | Timepoints of 0, 10, 20, 30, 60, and 120 min | 2 μM | 82.5 | Minutes | 4950 | SD rats plasma protease | Triple Quadrupole Mass spectrometry | SD rats plasma | In Vitro | None | None | Not mentioned | ||
| 37373203 | 2023 | HM-10/10 | 20 | Free | Free | Linear | L | None | Chimeric high-density lipoprotein mimetic peptide | Anticancer | 120 minutes | 2 μM | >120 | Minutes | 7200 | N.A. | Triple Quadrupole Mass spectrometry | potassium phosphate buffers of pH 1.3 (acidic) | In Vitro | None | None | Enzyme Activity = 0.682 at 2 microMolar of HM1010 (Cytochrome P450 (CYP1A2) Induction in Single-Donor Human Hepatocytes Lot HH1086) | ||
| 37373203 | 2023 | HM-10/10 | 20 | Free | Free | Linear | L | None | Chimeric high-density lipoprotein mimetic peptide | Anticancer | 120 minutes | 2 μM | >120 | Minutes | 7200 | N.A. | Triple Quadrupole Mass spectrometry | potassium phosphate buffers of pH 5.5 (slightly acidic) | In Vitro | None | None | Enzyme Activity = 0.682 at 2 microMolar of HM1010 (Cytochrome P450 (CYP1A2) Induction in Single-Donor Human Hepatocytes Lot HH1086) | ||
| 36982773 | 2023 | CEND-1 | 9 | Free | Free | Cyclic (C1-C9 Disulfide Bond) | L | None | iRGD cyclic peptide | Antitumor | 1 day | 3.2 mg/kg | 1.956 | Hours | 7041.6 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 36982773 | 2023 | CEND-1 | 9 | Free | Free | Cyclic (C1-C9 Disulfide Bond) | L | None | iRGD cyclic peptide | Antitumor | plasma samples were collected from patients before the CEND-1 infusion and at 3 min (±1 min), 15 min (±3 min), 30 min (±3 min), 1 hour (±5 min), ¾ h (±10 min) and 6/8 h (±10 min) after completion of the infusion (cycle 1 day 1 of nab-paclitaxel+gemcitabine chemotherapy treatment) (Combination therapy after 7 days of run in therapy) | 3.2 mg/kg | 1.725 | Hours | 6210 | Human plasma protease | N.A. | Human plasma after nab-paclitaxel and gemcitabine | In Vivo | None | None | N.A. | ||
| 36982773 | 2023 | CEND-1 | 9 | Free | Free | Cyclic (C1-C9 Disulfide Bond) | L | None | iRGD cyclic peptide | Antitumor | plasma samples were collected from patients before the CEND-1 infusion and at 3 min (±1 min), 15 min (±3 min), 30 min (±3 min), 1 hour (±5 min), ¾ h (±10 min) and 6/8 h (±10 min) after completion of the infusion (cycle 1 day 1 of nab-paclitaxel+gemcitabine chemotherapy treatment) (Combination therapy after 7 days of run in therapy) | 3.2 mg/kg | 1.598 | Hours | 5752.8 | Human plasma protease | LC-MS/MS | Human plasma after nab-paclitaxel and gemcitabine | In Vivo | None | None | N.A. | ||
| 36873181 | 2023 | DR3penA | 8 | Free | Amidation | Linear | L | α-(4-pentenyl)-Ala introduced at positions 3 of DR8 | DR8 analog | Alleviates Pulmonary Fibrosis | Samples were taken from the mixture at 0, 15, 30, 60, 120 and 240 min | 10 mmol/L | 174.63 ± 31.66 | Minutes | 10477.8 | Mice serum protease | RP-HPLC | C57BL/6 mice serum | In Vitro | None | None | DR3penA has Minimum effective concentration is 2.5 μmol/L in both TGF-β1-induced NIH3T3 cells and A549 cells | ||
| 36873181 | 2023 | DR4penA | 8 | Free | Amidation | Linear | L | α-(4-pentenyl)-Ala introduced at positions 4 of DR8 | DR8 analog | Alleviates Pulmonary Fibrosis | Samples were taken from the mixture at 0, 15, 30, 60, 120 and 240 min | 10 mmol/L | 270.65 ± 16.43 | Minutes | 16239 | Mice serum protease | RP-HPLC | C57BL/6 mice serum | In Vitro | None | None | DR8 has Minimum effective concentrations are 20 μmol/L in TGF-β1-induced NIH3T3 cells and 10 μmol/L in A549 cells | ||
| 36631971 | 2023 | 5k-prodrug | 23 | Onc72 N-terminally coupled via a short peptide linker LVPR to 5 kDa thiol PEGs | Amidation, Orn at position 23 | Linear | L | Orn at postion 19 | Oncocins | Antimicrobial | Prodrug and Onc72 concentrations were determined 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, and 24 h postadministration | 4.34 mmol/kg | 66 | Minutes | 3960 | CD-1 mice plasma protease | cELISA | CD-1 mice plasma | In Vivo | None | None | (Prodrugs of Onc72) MIC values >50 μmol L−1 on E.coli BW25113 | ||
| 36631971 | 2023 | 5k-prodrug | 23 | Onc72 N-terminally coupled via a short peptide linker LVPR to 5 kDa thiol PEGs | Amidation, Orn at position 23 | Linear | L | Orn at postion 19 | Oncocins | Antimicrobial | Prodrug and Onc72 concentrations were determined 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, and 24 h postadministration | 4.34 mmol/kg | 66 | Minutes | 3960 | CD-1 mice plasma protease | cELISA | CD-1 mice plasma | In Vivo | None | None | Prodrugs Showed negligible hemolytic activity (below 0.2%) up to the highest tested concentration (50 μmol L−1), similar to the negative control (PBS) | ||
| 36631971 | 2023 | 5k-prodrug | 23 | Onc72 N-terminally coupled via a short peptide linker LVPR to 5 kDa thiol PEGs | Amidation, Orn at position 23 | Linear | L | Orn at postion 19 | Oncocins | Antimicrobial | Prodrug and Onc72 concentrations were determined 5 min, 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, and 24 h postadministration | 4.34 mmol/kg | 66 | Minutes | 3960 | CD-1 mice plasma protease | cELISA | CD-1 mice plasma | In Vivo | None | None | 5 kDa thiol-PEG: Reduced cell viability to ≈89% for both HepG2 and HEK293 cell lines | ||
| 36631971 | 2023 | Onc72 | 19 | Free | Amidation, Orn=Ornithine at position 19 | Linear | L | Orn=Ornithine at position 15 | Synthetic | Antimicrobial | Aliquots weretaken in triplicates after 0, 1, 2, 4, and 8 h for Onc72 and 0, 4, 8, and 24 hfor both prodrugs | 31.5 μmol/L | ≈80 | Minutes | 4800 | Cell lysate protease (Obtained From An E. Coli Bw25113 Culture) | RP-HPLC | E. coli BW25113 cell lysate | In Vitro | None | None | (Onc72 in 19% MHB2 medium) MIC = 12.5 μmol L−1 (29 mg L−1) on E.coli BW25113 | ||
| 36630826 | 2023 | Exendin-4 | 39 | Free | Amidation | Linear | L | Fluorescently labeled | Isolated from the saliva of the Gila monster lizard (Heloderma suspectum) | Antidiabetes | Blood collection at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h | 1000 nmol kg−1 | 2.12 ± 0.3 (T1/2 Elimination) | Hours | 7632 | Naïve mice plasma protease | Fluorescence assay | Naïve mice plasma | In Vivo | PDB id: 7MLL | None | EC50 = 0.04 ± 0.01 nM for exendin | ||
| 36630826 | 2023 | Exendin-4 | 39 | Free | Amidation | Linear | L | Fluorescently labeled | Isolated from the saliva of the Gila monster lizard (Heloderma suspectum) | Antidiabetes | Blood collection at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h | 1000 nmol kg−1 | 1.88 ± 0.2(T1/2 Elimination) | Hours | 6768 | Naïve mice plasma protease | Fluorescence assay | Naïve mice plasma | In Vivo | PDB id: 7MLL | None | EC50 = 0.04 ± 0.01 nM for exendin | ||
| 36595440 | 2023 | TP0597850 (18) | 4 | Tripeptide linker {5-aminopentanoic acid [Ape(5)]–Glu–Asp} of 1 was replaced by a shorter linker (γ-D-Glu), X = Structure given in paper | Free | Linear | L | X=Structure given in paper | Synthetic | MMP2 Inhibitors | N.A. | N.A. | 265 | Minutes | 15900 | N.A. | N.A. | N.A. | N.A. | None | None | Ki = 0.034 nM for MM2 inhibition | ||
| 36630826 | 2023 | Exendin | 39 | Fluorescently labelled | Amidation | Linear | L | None | Derived from Gila monster | Antidiabetes | Ten μl of blood was collected from a tiny incision on the tail vein into tubes containing 90 μl of 1,000 U ml-1 heparin (Sigma) at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h. | 1000 nmol/kg | 2.12 ± 0.3 (T1/2 Elimination) | Hours | 7632 | Naïve mice plasma protease | fluorescence assay | Naïve mice plasma | In Vivo | PDB id: 7MLL | None | EC50 (nM) = 0.04 ± 0.01 | ||
| 36630826 | 2023 | Exendin | 39 | Fluorescently labelled | Amidation | Linear | L | None | Derived from Gila monster | Antidiabetes | Ten μl of blood was collected from a tiny incision on the tail vein into tubes containing 90 μl of 1,000 U ml-1 heparin (Sigma) at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h. | 1000 nmol/kg | 1.88 ± 0.2 (T1/2 Elimination) | Hours | 6768 | Immunized mice plasma protease | fluorescence assay | Immunized mice plasma | In Vivo | PDB id: 7MLL | None | EC50 (nM) = 0.04 ± 0.01 | ||
| 36997003 | 2023 | Compound 14 | 40 | Free | Amidation | Linear | Mix | D-Ser2 substiuition, Lys14 side chain linked to C16 fatty acid via linker yE-C16 | GLP-1 analogs | Dual GLP-1/Glucagon receptor agonist | The mice were sacrificed, and blood samples were collected after 0.083, 0.25, 1, 2, 4, 8, 16, and 24 h after application | 1 mg/kg | 3.2 | Hours | 11520 | C57/B16 female mice plasma protease | LC−MS/MS | C57/B16 female mice plasma | In Vivo | https://www.nature.com/articles/s41598-022-21251-y | None | GLP-1 receptor : EC50 = 3.9 pM | ||
| 36997003 | 2023 | Compound 15 | 41 | Free | Terminal Lys side chain linked to C16 fatty acid via linker yE-C16 at C terminal | Linear | Mix | D-Ser2 substiuition | GLP-1 analogs | Dual GLP-1/Glucagon receptor agonist | The mice were sacrificed, and blood samples were collected after 0.083, 0.25, 1, 2, 4, 8, 16, and 24 h after application | 1 mg/kg | 2.2 | Hours | 7920 | C57/B16 female mice plasma protease | LC−MS/MS | C57/B16 female mice plasma | In Vivo | https://www.nature.com/articles/s41598-022-21251-y | None | GLP-1 receptor : EC50 = 5.2 pM | ||
| 36997003 | 2023 | Liraglutide | 32 | Free | Free | Linear | L | Lys20 side chain linked to C16 fatty acid via linker yE-C16 | GLP-1 analogs | Dual GLP-1/Glucagon receptor agonist | The mice were sacrificed, and blood samples were collected after 0.083, 0.25, 1, 2, 4, 8, 16, and 24 h after application | 1 mg/kg | 3.6 | Hours | 12960 | C57/B16 female mice plasma protease | LC−MS/MS | C57/B16 female mice plasma | In Vivo | https://www.nature.com/articles/s41598-022-21251-y | None | GLP-1 receptor : EC50 = 6.4 pM | ||
| 36557850 | 2022 | LOC | 9 | Free | Leuprolide acetate with the hydroxyl groups of leuprolide acetate | Linear | Mix | Ole = oleic acid conjugation | Synthetic | Anticancer (Treatment of Advanced Prostate Cancer) | Blood sample of approximately 0.3 mL was collected via femoral artery cannulation at various time points (0, 1, 3, 5, 10, 20, 30, 60, 90, 120, 180, 240, 360, 480, and 600 min) | 0.122 mg/kg | 172 ± 66 (Terminal Elimination Half Life) | Minutes | 10320 | Male SD Rats Plasma Protease | UPLC-MS/MS | Male SD rats plasma | In Vivo | None | None | N.A. | ||
| 36557850 | 2022 | Leuprolide | 9 | pGlu = Pyroglutamate | NHEt (Ethylamine) | Linear | Mix | d-Leucine6 substituitions | Synthetic | Anticancer (Treatment of Advanced Prostate Cancer) | Blood sample of approximately 0.3 mL was collected via femoral artery cannulation at various time points (0, 1, 3, 5, 10, 20, 30, 60, 90, 120, 180, 240, 360, 480, and 600 min) | 0.1 mg/kg | 166 ± 38 | Minutes | 9960 | Male SD Rats Plasma Protease | UPLC-MS/MS | Male SD rats plasma after LOC peptide administration | In Vivo | None | None | N.A. | ||
| 36443381 | 2022 | SA10SC-RLX | 25 | Acetylation | Amidation | Linear | L | Attachment of a lipid moiety (C18-γ-Glu-PEG2) at K25 position, Aib, Nle,acetylation of Lys10 | Synthetic | Treatment for Chronic Fibrotic and Cardiovascular Diseases | Blood samples were collected from individual animals at the following time points: 0.083, 0.25, 0.5, 1, 3, 6, 8, 24, 48 and 72 h (IV route) and 0.25, 0.5, 1, 2, 4, 8, 12, 24, 48 and 72 h (SC route) | 1 mg/kg | 4 (Terminal Half Life) | Hours | 14400 | Rats plasma protease | LC-HRMS | Rats plasma | In Vivo | None | None | EC50 (nM) = 0.8 for EA.hy926_hRXFP1 | ||
| 36443291 | 2022 | Entry 2 (Azapeptide 51) | 4 | Aza-Phe at postion 1 | Amidation, Aza-glutamic acid (azaE4) modification at position 4 (E4) | Linear | L | None | P5779 analogues | Inhibitor of Hmgb1/Md-2/Tlr4 Complex Formation | Aliquots (200 μL) were taken at each time point (0, 5, 10, 15, 20, 30, 60 and 120 minutes) | 0.1 mg/ml | >120 | Minutes | 7200 | C57Bl/6 J mouse serum protease | LC-MS/MS | C57BL/6 J male mouse serum | In Vitro | None | None | HMGb1:MD-2 inhibition (IC50) = 90 nM | ||
| 36443291 | 2022 | Entry 3 (Azapeptide 52) | 4 | Aza-Phe at postion 1 | Amidation | Linear | L | None | P5779 analogues | Inhibitor of Hmgb1/Md-2/Tlr4 Complex Formation | Aliquots (200 μL) were taken at each time point (0, 5, 10, 15, 20, 30, 60 and 120 minutes) | 0.1 mg/ml | >120 | Minutes | 7200 | C57Bl/6 J mouse serum protease | LC-MS/MS | C57BL/6 J male mouse serum | In Vitro | None | None | HMGb1:MD-2 inhibition (IC50) = 249 nM | ||
| 36443291 | 2022 | Entry 5 (Azapeptide 54) | 4 | Aza-Phe at postion 1 | Amidation | Linear | L | None | P5779 analogues | Inhibitor of Hmgb1/Md-2/Tlr4 Complex Formation | Aliquots (200 μL) were taken at each time point (0, 5, 10, 15, 20, 30, 60 and 120 minutes) | 0.1 mg/ml | >120 | Minutes | 7200 | C57Bl/6 J mouse serum protease | LC-MS/MS | C57BL/6 J male mouse serum | In Vitro | None | None | HMGb1:MD-2 inhibition (IC50) = 127.4 nM | ||
| 36443291 | 2022 | Entry 7 (Azapeptide 56) | 4 | Aza-Phe at postion 1 | Amidation, Q amino acid subtituition at place of E at C terminal | Linear | L | None | P5779 analogues | Inhibitor of Hmgb1/Md-2/Tlr4 Complex Formation | Aliquots (200 μL) were taken at each time point (0, 5, 10, 15, 20, 30, 60 and 120 minutes) | 0.1 mg/ml | >120 | Minutes | 7200 | C57Bl/6 J mouse serum protease | LC-MS/MS | C57BL/6 J male mouse serum | In Vitro | None | None | HMGb1:MD-2 inhibition (IC50) = 348.7 nM | ||
| 36443291 | 2022 | Entry 8 (Azapeptide 57) | 4 | Aza-Phe at postion 1 | Amidation, Aza-glutamine (azaQ4) | Linear | L | None | P5779 analogues | Inhibitor of Hmgb1/Md-2/Tlr4 Complex Formation | Aliquots (200 μL) were taken at each time point (0, 5, 10, 15, 20, 30, 60 and 120 minutes) | 0.1 mg/ml | >120 | Minutes | 7200 | C57Bl/6 J mouse serum protease | LC-MS/MS | C57BL/6 J male mouse serum | In Vitro | None | None | HMGb1:MD-2 inhibition (IC50) = 83 nM | ||
| 36443291 | 2022 | Entry 11 ([azaF5, azaF8]-BK) | 9 | Free | Free | Linear | L | Modified at both positions 5 and 8 with aza-amino acids (aza-phenylalanine) | Aza-bradykinin analogues | Effects on Pain, Inflammation, Edema/Vasodilation and Blood Pressure | Aliquots (200 μL) were taken at each time point (0, 5, 10, 15, 20, 30, 60 and 120 minutes) | 0.1 mg/ml | 105.8 ± 1.8 | Minutes | 6348 | C57Bl/6 J mouse serum protease | LC-MS/MS | C57BL/6 J male mouse serum | In Vitro | None | None | N.A. | ||
| 36380917 | 2022 | Glc-GLP-1-1 | 31 | Free | Free | Linear | L | Glucosylation at Asn15 | GLP-1 analogs | Antidiabetes | 37 °C | 6 nmol | 94.1 ± 7.6 | Minutes | 5646 | Mouse serum protease | RP-HPLC | Mouse serum | In Vitro | None | None | N.A. | ||
| 36380917 | 2022 | Glc-GLP-1-3 | 31 | Free | Free | Linear | L | Glucosylation at Asn26 | GLP-1 analogs | Antidiabetes | 37 °C | 6 nmol | 138.8 ± 14.5 | Minutes | 8328 | Mouse serum protease | RP-HPLC | Mouse serum | In Vitro | None | None | N.A. | ||
| 36380917 | 2022 | Glc-GLP-1-5 | 31 | Free | Free | Linear | L | Glucosylation at Asn34 | GLP-1 analogs | Antidiabetes | 37 °C | 6 nmol | 113.3 ± 11.8 | Minutes | 6798 | Mouse serum protease | RP-HPLC | Mouse serum | In Vitro | None | None | N.A. | ||
| 36380917 | 2022 | Glycan-GLP-1-1(G2S2) | 31 | Free | Free | Linear | L | N-glycosylation with sialylated biantennary complex-type N-glycan at Asn15 (G2S2 glycoform = sialylated glycan) | GLP-1 analogs | Antidiabetes | 37 °C | 0.3 nmol | 145.7 ± 4.3 | Minutes | 8742 | DPP-IV | RP-HPLC | 50 mM Tris–HCl (pH 7.4) buffer + 10 ng μL−1 DPPIV | In Vitro | None | None | BGLmax (mmol L−1) = 28.71 ± 2.63 (In vivo glucose stabilizing capability) | ||
| 36380917 | 2022 | Glycan-GLP-1-3(G2) | 31 | Free | Free | Linear | L | N-glycosylation with biantennary complex-type N-glycan at Asn26 (G2 glycoform = glycan) | GLP-1 analogs | Antidiabetes | 37 °C | 0.3 nmol | 185.3 ± 1.1 | Minutes | 11118 | DPP-IV | RP-HPLC | 50 mM Tris–HCl (pH 7.4) buffer + 10 ng μL−1 DPPIV | In Vitro | None | None | BGLmax (mmol L−1) = 24.07 ± 3.79 (In vivo glucose stabilizing capability) | ||
| 36380917 | 2022 | Glycan-GLP-1-5(G2) | 31 | Free | Free | Linear | L | N-glycosylation with biantennary complex-type N-glycan at Asn34 (G2 glycoform = glycan) | GLP-1 analogs | Antidiabetes | 37 °C | 0.3 nmol | 182.0 ± 0.1 | Minutes | 10920 | DPP-IV | RP-HPLC | 50 mM Tris–HCl (pH 7.4) buffer + 10 ng μL−1 DPPIV | In Vitro | None | None | BGLmax (mmol L−1) = 14.50 ± 1.62 (In vivo glucose stabilizing capability) | ||
| 36380917 | 2022 | Glycan-GLP-1-5(G2S2) | 31 | Free | Free | Linear | L | N-glycosylation with sialylated biantennary complex-type N-glycan at Asn34 (G2S2 glycoform = sialylated glycan) | GLP-1 analogs | Antidiabetes | 37 °C | 0.3 nmol | 245.3 ± 1.3 | Minutes | 14718 | DPP-IV | RP-HPLC | 50 mM Tris–HCl (pH 7.4) buffer + 10 ng μL−1 DPPIV | In Vitro | None | None | BGLmax (mmol L−1) = 15.50 ± 3.74 (In vivo glucose stabilizing capability) | ||
| 36323988 | 2022 | Glepaglutide parent | 39 | Free | Six lysines has been added at C terminal | Linear | L | None | GLP-2 analogue | Treatment of Short Bowel Syndrome | blood sampling in subjects receiving 5 and 10 mg of glepaglutide once weekly occurred at the day 1 visit (pre-dose and 0.5, 1, 2, 4, 8, 12, 16, 20, 24, 36, 48, 60, 72, 96 and 120 h post-dose); pre-dose on days 8, 15, 22 and 29; and in connection with the last dosing visit on day 36 (pre-dose and 0.5, 1, 2, 4, 8, 12, 16, 20, 24, 36, 48, 72, 120, 168, 336, 504, 672 and 840 h post-dose) | 5 mg | 3.8 | Hours | 13680 | Human plasma protease | LC-MS | Human plasma after SC glepaglutide 5 mg after 6 once-weekly doses | In Vivo | None | None | EC50 = 0.12 nM In vitro potency | ||
| 36323988 | 2022 | Glepaglutide parent | 39 | Free | Six lysines has been added at C terminal , Amidation | Linear | L | None | GLP-2 analogue | Treatment of Short Bowel Syndrome | blood sampling in subjects receiving 5 and 10 mg of glepaglutide once weekly occurred at the day 1 visit (pre-dose and 0.5, 1, 2, 4, 8, 12, 16, 20, 24, 36, 48, 60, 72, 96 and 120 h post-dose); pre-dose on days 8, 15, 22 and 29; and in connection with the last dosing visit on day 36 (pre-dose and 0.5, 1, 2, 4, 8, 12, 16, 20, 24, 36, 48, 72, 120, 168, 336, 504, 672 and 840 h post-dose) | 10 mg | 2.8 | Hours | 10080 | Human plasma protease | LC-MS | Human plasma after SC glepaglutide 5 mg after 6 once-weekly doses | In Vivo | None | None | EC50 = 0.12 nM In vitro potency | ||
| 36323988 | 2022 | Glepaglutide M1 | 35 | Free | Two lysines has been added at C terminal | Linear | L | None | GLP-2 analogue | Treatment of Short Bowel Syndrome | Blood sampling for a pharmacokineticanalysis in these subjects was conducted pre-dose and at 5,10, 15, 20, 25, 35, 45, 60, 75 and 90 min and 2, 3, 4, 8, 12,16, 20, 24, 36 and 48 h after the start of the IV infusion, and again on day 22 | 1 mg | 1.2 | Hours | 4320 | Human plasma protease | LC-MS | Human plasma | In Vivo | None | None | EC50 = 0.068 nM In vitro potency | ||
| 36323988 | 2022 | Glepaglutide M2 | 34 | Free | 1 lysines has been added at C terminal | Linear | L | None | GLP-2 analogue | Treatment of Short Bowel Syndrome | Blood sampling for a pharmacokineticanalysis in these subjects was conducted pre-dose and at 5,10, 15, 20, 25, 35, 45, 60, 75 and 90 min and 2, 3, 4, 8, 12,16, 20, 24, 36 and 48 h after the start of the IV infusion, and again on day 22 | 1 mg | 2.6 | Hours | 9360 | Human plasma protease | LC-MS | Human plasma | In Vivo | None | None | EC50 = 0.044 nM In vitro potency | ||
| 36232550 | 2022 | ASK2131 | 9 | Free | Free | Cyclic (C1-C6 Disulfide Bond) | L | Native oxytocin peptide was modified with a substitution of the Leu8 to a Lys appended with a polyethylene glycol space and a palmitoyl group and with a substitution of Gly for the Pro7 | OXT analogs | Antiobesity | Serial blood samples (200 µL per time point) were obtained via tail nick using K3EDTA microvettes prior to and 1, 2, 4, 6, 12, and 24-h post-drug administration | 300 nmol/kg | 2.3 | Hours | 8280 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vivo | None | None | EC50 = 1.1 nM (ASK2131 profile against OXTR ) | ||
| 36232550 | 2022 | ASK2131 | 9 | Free | Free | Cyclic (C1-C6 Disulfide Bond) | L | Native oxytocin peptide was modified with a substitution of the Leu8 to a Lys appended with a polyethylene glycol space and a palmitoyl group and with a substitution of Gly for the Pro7 | OXT analogs | Antiobesity | Serial blood samples (200 µL per time point) were obtained via tail nick using K3EDTA microvettes prior to and 1, 2, 4, 6, 12, and 24-h post-drug administration | 300 nmol/kg | 2.3 | Hours | 8280 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vivo | None | None | hV1aR, EC50 (nM) > 1000 | ||
| 36232550 | 2022 | ASK2131 | 9 | Free | Free | Cyclic (C1-C6 Disulfide Bond) | L | Native oxytocin peptide was modified with a substitution of the Leu8 to a Lys appended with a polyethylene glycol space and a palmitoyl group and with a substitution of Gly for the Pro7 | OXT analogs | Antiobesity | Serial blood samples (200 µL per time point) were obtained via tail nick using K3EDTA microvettes prior to and 1, 2, 4, 6, 12, and 24-h post-drug administration | 300 nmol/kg | 2.3 | Hours | 8280 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vivo | None | None | hV2R, EC50 (nM) = 0.36 | ||
| 36142749 | 2022 | [Ile9]PK20 | 10 | Replacing tyrosine (Tyr) with 2,6-dimethyltyrosine (Dmt) at position 1 | Free | Linear | Mix | D-amino acid residue (D-Lys) inserted at position 2 | PK20 derivative | Analgesic | 37°C for 24 h | 50 μg/mL | 4.69 | Hours | 16884 | N.A. | LC-MS | 1M NaOH | In Vitro | None | None | EC50 = 1244 nM (potency at mu opioid receptor) | ||
| 36135098 | 2022 | GNRs-AAP1-2-Cy5 | 7 | Free | Free | Linear | L | Cy5 conjugation | AAP1/AAP1-1/AAP1-2 modified GNRs | Antiadhesive property | At 0, 0.08, 0.16, 0.33, 0.5, 1, 2, 6, 12, 24, 48, 72 h, adding 40 μL termination solution | 1 mg/ml | 5 (T1/2 Β ) | Hours | 18000 | Mouse serum protease | HPLC | 1 mL mouse serum | In Vitro | None | None | N.A. | ||
| 36112771 | 2022 | BT8009 | 16 | Acetylation | Conjugation to MMAE cytotoxin via a valine–citrulline (V-Citr) cleavable linker,Val-Citriline linker and BTC joined by spacer Sar10 | Bicyclic | Mix | cyclised on TATA (1,3,5-Triacryloylhexahydro-1,3,5-triazine), 1Nal - 3-(1-naphthyl)-L-alanine, HArg – homo-arginine, HyP – hydroxyproline, MMAE = Monomethyl auristatin E, Cys16 with amidation modification, D-Asp4 modification | BT8009 and MMAE cytotoxin hybrid | Anticancer | N.A. | 1.25 mg/kg | 1.7 | Hours | 6120 | NHP plasma protease | LC-MS/MS | NHP plasma | In Vivo | None | None | KD(nM) = 6.3±1.3 (Binding affinity for BT8009 binding to extracellular domains of Nectin-4 in NHP) | ||
| 36112771 | 2022 | BT8009 | 16 | Acetylation | Conjugation to MMAE cytotoxin via a valine–citrulline (V-Citr) cleavable linker,Val-Citriline linker and BTC joined by spacer Sar10 | Bicyclic | Mix | cyclised on TATA (1,3,5-Triacryloylhexahydro-1,3,5-triazine), 1Nal - 3-(1-naphthyl)-L-alanine, HArg – homo-arginine, HyP – hydroxyproline, MMAE = Monomethyl auristatin E, Cys16 with amidation modification, D-Asp4 modification | BT8009 and MMAE cytotoxin hybrid | Anticancer | 24 hours | 2 µM | 2.3 - 4.4 | Hours | 8280 | Mouse plasma protease | LC-MS/MS | Mouse plasma | In Vitro | None | None | KD(nM) = 2.9±1.1 (Binding affinity for BT8009 binding to extracellular domains of Nectin-4 in Mouse) | ||
| 36112771 | 2022 | BT8009 | 16 | Acetylation | Conjugation to MMAE cytotoxin via a valine–citrulline (V-Citr) cleavable linker,Val-Citriline linker and BTC joined by spacer Sar10 | Bicyclic | Mix | cyclised on TATA (1,3,5-Triacryloylhexahydro-1,3,5-triazine), 1Nal - 3-(1-naphthyl)-L-alanine, HArg – homo-arginine, HyP – hydroxyproline, MMAE = Monomethyl auristatin E, Cys16 with amidation modification, D-Asp4 modification | BT8009 and MMAE cytotoxin hybrid | Anticancer | 24 hours | 2 µM | 5 | Hours | 18000 | Mouse blood protease | LC-MS/MS | Mouse blood sample | In Vitro | None | None | KD(nM) = 2.9±1.1 (Binding affinity for BT8009 binding to extracellular domains of Nectin-4 in Mouse) | ||
| 36047255 | 2022 | MTP-CAL/TAN NS | 5 | Free | MTP/RGD comodified with CAL/TAN NS (PEG-DSPE) | Linear | Mix | Dmt: 2',6'-dimethyltyrosine at position 3, D-Arg2 modification | Synthetic | Treatment of Acute Myocardial Infarction (Ami) | Blood samples were obtained at determined times until 72 h after injection and 15 μL of heparin (1000 U/mL) was added to each sample | 10 mg/kg | 4.59 | Hours | 16524 | AMI rats plasma protease | N.A. | AMI rats plasma | In Vivo | None | None | Blank MTP/RGD NS and RGD-PEG-DSPE groups showed over 85% of cell viability. In contrast, drugs contained formulations exhibited cytotoxicity to some extent. | ||
| 36034808 | 2022 | uPAR | 335 | Free | Free | Linear | L | None | Derived from PLAUR gene | Plays role in thrombosis | N.A. | N.A. | 209.6 ± 0.2 | Minutes | 12576 | BEAS-2B cells lysate protease | Densitometry analysis using NIH Image J | BEAS-2B cells lysate with UK treatment +H/R (Hypoxia/Reoxygenation) + Cycloheximide | In Vivo | None | None | N.A. | ||
| 35971165 | 2022 | AR pep‐PROTAC | 33 | Free | Free | Linear | L | None | Synthetic | Anticancer (Prostate Cancer Therapy) | N.A. | N.A. | 1.9 | Hours | 6840 | PBS containing 10% serum protease | HPLC | PBS containing 10% serum | In Vitro | None | None | IC50 of Au‐AR pep‐PROTAC on AML 12 cells is 2.41 µM | ||
| 35890224 | 2022 | 177Lu-Palm-3PRGD2 | 2 | Lys1 linked with (palmitoyl-Glu-OH) | Glu3 linked with (PEG4-c(RGDfK))2 | Cyclic (3PRGD2) | Mix | 177Lu radiolabeling at PEG4, Lys1 and Glu2 linked with PEG4 in between | Synthetic | Antitumor | N.A. | 0.74 MBq | 73.42 (T1/2Β) | Minutes | 4405.2 | KM mice blood protease | Gamma counter | KM mice blood sample | In Vivo | None | None | N.A. | ||
| 35890224 | 2022 | 177Lu-Palm-3PRGD2 | 2 | Lys1 linked with (palmitoyl-Glu-OH) | Glu3 linked with (PEG4-c(RGDfK))2 | Cyclic (3PRGD2) | Mix | 177Lu radiolabeling at PEG4, Lys1 and Glu2 linked with PEG4 in between | Synthetic | Antitumor | N.A. | 0.74 MBq | 63.71 (Slow) | Minutes | 3822.6 | C57Bl/6 mice blood protease | Gamma counter | C57BL/6 mice blood sample | In Vivo | None | None | N.A. | ||
| 35850571 | 2022 | dTBP2 | 7 | Free | Free | Linear | L | None | dTCTP-binding peptide-2 | Antiinflammatory | Blood samples were collected from the orbital sinus at 0.083, 0.25, 0.5, 1, 2, 4, and 8 h after dosing with dTBP2 or PEG-dTBP2 | 10 mg/kg | 1.01 ± 0.25 | Hours | 3636 | ICR male mice orbital sinus plasma protease | LC-MS/MS | ICR Male mice orbital sinus plasma | In Vivo | None | None | dTBP2 results in 30% inhibition of inflammatory cell infiltration in BALF compared to the OVA-challenged group | ||
| 35850571 | 2022 | PEG-dTBP2 | 7 | PEGylation (mPEG) | Free | Linear | L | None | dTCTP-binding peptide-2 | Antiinflammatory | Blood samples were collected from the orbital sinus at 0.083, 0.25, 0.5, 1, 2, 4, and 8 h after dosing with dTBP2 or PEG-dTBP2 | 10 mg/kg | 2.57 ± 1.11 | Hours | 9252 | ICR male mice orbital sinus plasma protease | LC-MS/MS | ICR Male mice orbital sinus plasma | In Vivo | None | None | PEG-dTBP2 results in 45% inhibition, indicating that PEGylation enhances the anti-inflammatory effects of dTBP2 | ||
| 35772783 | 2022 | DR7dA | 8 | Free | Amidation | Linear | Mix | Replacing the isoleucine (Ile7) residue with D-alanine7 (D-Ala) | DR8 analog | Ameliorated Tumor Growth Factor (Tgf)-B1-Induced Fibrogenesis And Bleomycin-Induced Pf | An aliquot of 40 ml was taken at 0, 15, 30, 60, 120 and 240 min | 10 mM | 201.08 ± 58.86 | Minutes | 12064.8 | Mouse serum protease | RP-HPLC | Mouse serum | In Vitro | None | None | DR7dA showed no cytotoxic effects in A549 and NIH3T3 cells even at high concentrations (up to 160 μM) | ||
| 35772783 | 2022 | DR8 | 8 | Free | Amidation | Linear | L | None | Derived from rapeseed protein | Ameliorated Tumor Growth Factor (Tgf)-B1-Induced Fibrogenesis And Bleomycin-Induced Pf | An aliquot of 40 ml was taken at 0, 15, 30, 60, 120 and 240 min | 10 mM | 70.19 ± 6.83 | Minutes | 4211.4 | Mouse serum protease | RP-HPLC | Mouse serum | In Vitro | None | None | The effective concentration of DR8 was higher than that of DR7dA in both cell lines, indicating that DR7dA is more potent in inhibiting fibrosis | ||
| 35677307 | 2022 | rhG-CSF | 175 | Free | Free | Linear | L | None | Recombinant human methionyl-granulocyte colonystimulating factor | N.A. | Sampling time - 0, 0.083, 0.25, 0.5, 1, 2, 4, 8, 12, 24 h | 1.0 mg/kg | 2.74 ± 0.33 | Hours | 9864 | Mice Serum Protease | ELISA | Mice serum | In Vivo | None | None | N.A. | ||
| 35653695 | 2022 | KLK5 inhibitor | 11 | Free | A short linker GKG was attached at C terminal and then ALbumin tag was linked with Lys via PEG2 | Cyclic (C2-C8 Disulfide Bond) | L | None | Synthetic | Treatment for Netherton syndrome | N.A. | 6.2 mg/kg | 4.4 ± 0.3 (Terminal Half Life) | Hours | 15840 | Mice plasma protease | HPLC analysis with fluorescence detection | Mice plasma | In Vivo | None | None | Ki(KLK5)(nM) = 1.2, Kd(albumin)(nM) = 119 (for KLK5(1)-tag) | ||
| 35646543 | 2022 | TB001 | 40 | Free | Amidation, GGPSSGAPPPS introduced in the C-terminal | Cyclic (R17-D21 Lactam Bridge) | Mix | D serine modifcation at 2, side chain modification at Lysine (n=12, R=CH3) | GLP-1 and GCG chimera analog | Treatment of Multiple Causes of Hepatic Fibrosis | N.A. | 5 μg/kg | 3.33 ± 1.57 | Hours | 11988 | Rhesus monkeys plasma protease | HPLC–MS/MS | Rhesus monkeys plasma | In Vivo | None | None | GCGR EC50(nmol/L) = 0.01, GLP-1R EC50(nmol/L) = 0.04 | ||
| 35646543 | 2022 | TB001 | 40 | Free | Amidation, GGPSSGAPPPS introduced in the C-terminal | Cyclic (R17-D21 Lactam Bridge) | Mix | D serine modifcation at 2, side chain modification at Lysine (n=12, R=CH3) | GLP-1 and GCG chimera analog | Treatment of Multiple Causes of Hepatic Fibrosis | N.A. | 20 μg/kg | 2.83 ± 1.42 | Hours | 10188 | Rhesus monkeys plasma protease | HPLC–MS/MS | Rhesus monkeys plasma | In Vivo | None | None | GCGR EC50(nmol/L) = 0.01, GLP-1R EC50(nmol/L) = 0.04 | ||
| 35646543 | 2022 | TB001 | 40 | Free | Amidation, GGPSSGAPPPS introduced in the C-terminal | Cyclic (R17-D21 Lactam Bridge) | Mix | D serine modifcation at 2, side chain modification at Lysine (n=12, R=CH3) | GLP-1 and GCG chimera analog | Treatment of Multiple Causes of Hepatic Fibrosis | N.A. | 60 μg/kg | 2.47 ± 0.571 | Hours | 8892 | Rhesus monkeys plasma protease | HPLC–MS/MS | Rhesus monkeys plasma | In Vivo | None | None | GCGR EC50(nmol/L) = 0.01, GLP-1R EC50(nmol/L) = 0.04 | ||
| 35646543 | 2022 | TB001 | 40 | Free | Amidation, GGPSSGAPPPS introduced in the C-terminal | Cyclic (R17-D21 Lactam Bridge) | Mix | D serine modifcation at 2, side chain modification at Lysine (n=12, R=CH3) | GLP-1 and GCG chimera analog | Treatment of Multiple Causes of Hepatic Fibrosis | 1 day | 20 μg/kg | 3.07 ± 1.28 | Hours | 11052 | Rhesus monkeys plasma protease | HPLC–MS/MS | Rhesus monkeys plasma | In Vivo | None | None | GCGR EC50(nmol/L) = 0.01, GLP-1R EC50(nmol/L) = 0.04 | ||
| 35646543 | 2022 | TB001 | 40 | Free | Amidation, GGPSSGAPPPS introduced in the C-terminal | Cyclic (R17-D21 Lactam Bridge) | Mix | D serine modifcation at 2, side chain modification at Lysine (n=12, R=CH3) | GLP-1 and GCG chimera analog | Treatment of Multiple Causes of Hepatic Fibrosis | 7 days | 20 μg/kg | 1.94 ± 0.305 | Hours | 6984 | Rhesus monkeys plasma protease | HPLC–MS/MS | Rhesus monkeys plasma | In Vivo | None | None | GCGR EC50(nmol/L) = 0.01, GLP-1R EC50(nmol/L) = 0.04 | ||
| 35458385 | 2022 | EK1 | 36 | Free | Free | Linear | L | None | Expression in E. coli | Pan-cov fusion inhibitor | Serum samples were collected before (0 h) and after injection of EK1 (0.5 h, 1 h, 3 h, 7 h, and 12 h) or FL-EK1 (0.5 h, 1 h, 3 h, 7 h, 24 h, 48 h, 72 h, and 96 h) | 8.25 mg/kg | 1.8 ± 1.0 | Hours | 6480 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | None | None | IC50(nM) = 69.0 ± 20.8 against B.1.1.7 (Alpha), IC50(nM) = 109.9 ± 25.3 against B.1.351 (Beta), IC50(nM) = 191.3 ± 17.0 against P.1 (Gamma), IC50(nM) = 190.6 ± 29.0 against B.1.617.2 (Delta), IC50(nM) = 135.6 ± 11.2 against B.1.525 (Eta), IC50(nM) = 107.1 ± 7.3 against B.1.617.1 (Kappa), IC50(nM) = 68.7 ± 25.4 against C.37 (Lambda), IC50(nM) = 236.8 ± 10.6 against B.1.1.529 (Omicron) | ||
| 35455421 | 2022 | T20 (enfuvirtide) | 36 | Free | Free | Linear | L | None | Derived from the natural sequence (aa 643–678) of the HIV-1 gp41 C-terminal heptad repeat (CHR) domain | Antiviral (HIV fusion inhibitor) | Blood samples were collected from the orbital sinus at 0, 0.5, 1.5, 3, 6, 9, 12, 24, 48, 72, 96 and 120 h after injection of the inhibitors tested | 1.26 mg/kg | 1.22 ± 0.2 | Hours | 4392 | Rats serum protease | Sandwich ELISA | Rats serum | In Vivo | None | None | IC50(nM)= 55.3 ± 2.4 against HIV-1 96USSN20 (X4/R5, A),IC50(nM) = 49.3 ± 4.9 against HIV-1 96USNG17 (X4, A), IC50(nM) = 50.1 ± 2.0 against HIV-1 90US_873 (R5, B), IC50(nM) =53.9 ± 4.3 against HIV-1 BZ167 (X4, B), IC50(nM) = 45.2 ± 3.2 against HIV-1 SE364 (R5, C), IC50(nM) = 46.9 ± 2.1 against HIV-1 PBL288 (R5, C), IC50(nM) = 77.1 ± 6.8 against HIV-1 92UG001 (X4/R5, D), IC50(nM) = 21.1 ± 1.1 against HIV-1 J32228M4 (R5, D), IC50(nM) = 55.6 ± 1.2 against HIV-1 DJ263 (R5, CRF02_AG), IC50(nM) = 61.2 ± 1.3 against HIV-1 CAM1475MV (R5, CRF02_AG) (infection on MT-4 cell) | ||
| 35438695 | 2022 | SFQSeM | 3 | Free | Selenium methylated conjugation at C terminal | Linear | L | None | From soybeans | Effective Se nutritional supplement | N.A. | N.A. | 81.60 ± 11.88 | Minutes | 4896 | N.A. | N.A. | N.A. | N.A. | None | None | N.A. | ||
| 35414877 | 2022 | B_3.2 | 25 | Acetylation | Amidation, FLAG tag | Linear | L | None | Synthetic | Targets GIP receptor | At selected time points samples were taken: 5, 15, 30, 60, 120, 210, 300 mins | 1 μM | ~2 | Hours | 7200 | Human plasma protease | LC-MS | 80% pooled human Li-heparin plasma | In Vitro | None | None | IC50(nM) = 7890 | ||
| 35414877 | 2022 | B_1275 | 25 | Acetylation | Amidation, FLAG tag | Cyclic | L | None | Synthetic | Targets GIP receptor | At selected time points samples were taken: 5, 15, 30, 60, 120, 210, 300 mins | 1 μM | ~3.5 | Hours | 12600 | Human plasma protease | LC-MS | 80% pooled human Li-heparin plasma | In Vitro | None | None | IC50(nM) = 2076 | ||
| 35414877 | 2022 | B_1275.2 | 25 | Acetylation | Amidation, FLAG tag | Linear | L | None | Synthetic | Targets GIP receptor | At selected time points samples were taken: 5, 15, 30, 60, 120, 210, 300 mins | 1 μM | ~2 | Hours | 7200 | Human plasma protease | LC-MS | 80% pooled human Li-heparin plasma | In Vitro | None | None | IC50(nM) = 8336 | ||
| 35414877 | 2022 | B_1275.4 | 25 | Acetylation | Amidation, FLAG tag | Cyclic | L | None | Synthetic | Targets GIP receptor | N.A. | 2 μM | 3.767 (Elimination half life) | Minutes | 13560 | Rats plasma protease | LC-MS | Rats plasma | In Vivo | None | None | IC50(nM) = 826 | ||
| 35414877 | 2022 | B_1275.5 | 14 | Acetylation | Free | Cyclic | L | None | Synthetic | Targets GIP receptor | N.A. | 2 μM | 2.367 (Elimination half life) | Minutes | 15720 | Rats plasma protease | LC-MS | Rats plasma | In Vivo | None | None | IC50(nM) = 2300 | ||
| 35414877 | 2022 | B_1275.6 | 14 | C18 diacid-gGlu-2xOEG | Free | Cyclic | L | None | Synthetic | Targets GIP receptor | N.A. | 2 μM | 250 (Elimination Half Life) | Minutes | 15000 | Rats plasma protease | LC-MS | Rats plasma | In Vivo | None | None | IC50(nM) = 860 | ||
| 35359494 | 2022 | CSP1-E1A/F7Cha | 17 | Free | Free | Linear | L | introduction of Cha = cyclohexylalanine residues at position 7,E1A substituitions | CSP1 analog | Modulates Quorum Sensing In Streptococcus Pneumoniae | Aliquots (100 μL) were taken at 0, 0.5, 1, 2, 3, 4, 5, 6, and 24 h time points | 1 mM | 4 | Hours | 14400 | Trypsin | RP-HPLC | PBS solution | In Vitro | None | None | IC50(nM) = 36 for CSP1-E1A/F7Cha against ComD1 receptor | ||
| 35359494 | 2022 | CSP1-E1A/F7Cha | 17 | Free | Free | Linear | L | introduction of Cha = cyclohexylalanine residues at position 7 | CSP1 analog | Modulates Quorum Sensing In Streptococcus Pneumoniae | Aliquots (100 μL) were taken at 0, 0.5, 1, 2, 3, 4, 5, 6, and 24 h time points | 1 mM | 4 | Hours | 14400 | Chymotrypsin | RP-HPLC | PBS solution | In Vitro | None | None | IC50(nM) = 36 for CSP1-E1A/F7Cha against ComD1 receptor | ||
| 35359494 | 2022 | CSP1-F7Cha/I12Cha | 17 | Free | Free | Linear | L | introduction of Cha residues at positions 7 and 12 | CSP1 analog | Modulates Quorum Sensing In Streptococcus Pneumoniae | Aliquots (100 μL) were taken at 0, 0.5, 1, 2, 3, 4, 5, 6, and 24 h time points | 1 mM | 3 | Hours | 10800 | Trypsin | RP-HPLC | PBS solution | In Vitro | None | None | EC50(nM) = 0.97 for CSP1-F7Cha/I12Cha against ComD1 receptor, EC50(nM) = 70 for CSP1-F7Cha/I12Cha against ComD2 receptor | ||
| 35046019 | 2022 | ELP(0FA)GFP | 400 | Free | GFP | Linear | L | None | ELP-GFP conjugate | Increases Half Life | 1 week | 10 μM | 1.6 | Hours | 5760 | C57Bl/6J mice blood plasma protease | GFP-specific ELISA | C57BL/6J mice blood plasma | In Vivo | None | None | KD MSA - Mouse serum albumin (μM) = n.d. (Binding affinity of ELP-GFP constructs for serum albumin), KD HSA - Human serum albumin (μM) = n.d | ||
| 35046019 | 2022 | ELP(1FA)GFP | 400 | Free | GFP | Linear | L | 1 Fatty acid conjugation through pAzF (para-azidophenylalanine) | ELP-GFP conjugate | Increases Half Life | 1 week | 10 μM | 1.9 | Hours | 6840 | C57Bl/6J mice blood plasma protease | GFP-specific ELISA | C57BL/6J mice blood plasma | In Vivo | None | None | KD MSA (μM) = 126 ± 32.2, KD HSA - Human serum albumin (μM) = n.d | ||
| 34217775 | 2022 | FE 205030 | 10 | Oxazole-2-carbonyl, D-val at position 1 | Amidation | Cyclic (C3-C10 disulfide bond) | Mix | Phe linked with (2-Cbm),3Pal, Orn linked with iPr | Derived from CGRP | Treatment of Acute Episodic Migraine | Blood sample was collected at 2, 6, 10, 15, 20, 40, 60, 90, 135, 180 min | 0.1 mg/kg | 82 ± 9 | Minutes | 4920 | Male göttingen minipigs plasma protease | LC-MS/MS | Male göttingen minipigs plasma | In Vivo | None | None | Rat (%Plasma Protein Binding) = 9 ± 3, Human(%Plasma Protein Binding) = 17 ± 2 for FE 205030 | ||
| 34217775 | 2022 | FE 205030 | 10 | Oxazole-2-carbonyl, D-val at position 1 | Amidation, 3-Pal modification at C terminal | Cyclic (C3-C10 disulfide bond) | Mix | Phe linked with (2-Cbm),3Pal, Orn linked with iPr | Derived from CGRP | Treatment of Acute Episodic Migraine | Blood sample was collected at 5, 10, 20, 40, 60, 90, 120, 180, 240, 300 min | 0.25 mg/kg | 264 ± 80 | Minutes | 15840 | Male göttingen minipigs plasma protease | LC-MS/MS | Male göttingen minipigs plasma | In Vivo | None | None | Rat (%Plasma Protein Binding) = 9 ± 3, Human(%Plasma Protein Binding) = 17 ± 2 for FE 205030 | ||
| 34217775 | 2022 | FE 992325 | 10 | D-val at position 1 | Amidation, 3-Pal modification at C terminal | Cyclic (C3-C10 disulfide bond) | Mix | Agp | Derived from CGRP | Treatment of Acute Episodic Migraine | Blood sample was collected at 2, 6, 10, 15, 20, 30, 45, 60, 90, 120 min | 0.2 mg/kg | 69 ± 7 | Minutes | 4140 | Male cynomolgus monkeys plasma protease | LC-MS/MS | Male cynomolgus monkeys plasma | In Vivo | None | None | Rat (%Plasma Protein Binding) = 50 ± 5, Human(%Plasma Protein Binding) = 46 ± 4 for FE 992325 | ||
| 34217775 | 2022 | FE 205030 | 10 | Oxazole-2-carbonyl, D-val at position 1 | Amidation, 3-Pal modification at C terminal | Cyclic (C3-C10 disulfide bond) | Mix | Phe linked with (2-Cbm),3Pal, Orn linked with iPr | Derived from CGRP | Treatment of Acute Episodic Migraine | Blood sample was collected at 2, 6, 10, 15, 20, 40, 60, 90, 135, 180 min | 0.1 mg/kg | 65 ± 5 | Minutes | 3900 | Male cynomolgus monkeys plasma protease | LC-MS/MS | Male cynomolgus monkeys plasma | In Vivo | None | None | Rat (%Plasma Protein Binding) = 9 ± 3, Human(%Plasma Protein Binding) = 17 ± 2 for FE 205030 | ||
| US 201916457763 A | 2022 | Alb-e9-XPLGLAG-r9-k(cy5) | 25 | Alb=albumin | Cy5 linked with Lys side chain at C terminus | Linear | Mix | e=D-Glutamic acid, r=D-Aspartic acid, k=D-Lys, Alb=albumin, Cy5 = indocarbocyanine dye conjugated with Lys at C terminal, X=linker | Synthetic | Transport molecule | Blood was collected in a heparinized capillary tube at 30 minutes and 1, 2 And 6 hour time points | 4.8 nmol | 3 | Hours | 10800 | Mice blood plasma protease | N.A. | Mice blood plasma | In Vivo | None | US 201916457763 A | N.A. | ||
| US 201916457763 A | 2022 | Streptavidin-[e9-XPLGLAG-r9-k(cy5)]4 | 100 | Streptavidin | Cy5 linked with Lys side chain at C terminus | Linear | Mix | e=D-Glutamic acid, r=D-Aspartic acid, k=D-Lys, Strep=Streptavidin, Cy5 = indocarbocyanine dye conjugated with Lys at C terminal, X=linker | Synthetic | Transport molecule | Blood was collected in a heparinized capillary tube at 30 minutes and 1, 2 And 6 hour time points | 4 nmol | 4 | Hours | 14400 | Mice blood plasma protease | N.A. | Mice blood plasma | In Vivo | None | US 201916457763 A | N.A. | ||
| US 2021/0062261 W | 2022 | TROP2 TCE (PC1) | 692 | Free | Fab heavy chain linked to C terminus of ScFv light chain | Linear | L | None | Synthetic | Mediates tumor cytotoxicity and T cell activation | N.A. | 3 ug/kg | 1.02 | Hours | 3672 | Cynomolgus monkeys plasma protease | ELISA | Cynomolgus monkeys plasma | In Vivo | None | US 2021/0062261 W | EC50(nM) = 0.1477 (TROP binding) | ||
| US 201615754395 A | 2022 | Example 1 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)tetradecanedioyl-gGlu-2×OEG), B3E, B27E, B28E modifications, , A and B chain linked with disulfide bond | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1 nmol/kg | 103 | Minutes | 6180 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | hIGF1R 0.1% HSA (% rel to HI) Ex48 = 66.3 | ||
| US 201615754395 A | 2022 | Example 7 | 51 | Free | B29R, desB30 modificaiton | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)tetradecanedioyl-gGlu-2×OEG), B3E, B28D modifications, A and B chain linked with disulfide bond | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1 nmol/kg | 86 | Minutes | 5160 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | hIGF1R 0.1% HSA (% rel to HI) Ex48 = 124.4 | ||
| US 201615754395 A | 2022 | Example 10 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)tetradecanedioyl-4×gGlu), B3E, B28D modifications, A and B chain linked with disulfide bond | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1 nmol/kg | 97 | Minutes | 5820 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | hIGF1R 0.1% HSA (% rel to HI) Ex48 = 77.3 | ||
| US 201615754395 A | 2022 | Example 45 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)hexadecanedioyl-4×gGlu-2×OEG), B3E, B26E modifications | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 713 pmol/kg | 182 | Minutes | 10920 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | N.A. | ||
| US 201615754395 A | 2022 | Example 45 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)hexadecanedioyl-4×gGlu-2×OEG), B3E, B26E modifications | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1714 pmol/kg | 148 | Minutes | 8880 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | N.A. | ||
| US 201615754395 A | 2022 | Example 45 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)hexadecanedioyl-4×gGlu-2×OEG), B3E, B26E modifications | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 720 pmol/kg | 153 | Minutes | 9180 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | N.A. | ||
| US 201615754395 A | 2022 | Example 45 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)hexadecanedioyl-4×gGlu-2×OEG), B3E, B26E modifications | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 706 pmol/kg | 158 | Minutes | 9480 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | N.A. | ||
| US 201615754395 A | 2022 | Example 45 | 51 | Free | B29R, desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)hexadecanedioyl-4×gGlu-2×OEG), B3E, B26E modifications | Insulin Derivative | Antidiabetes | Blood sample taken at the following time points: Predose (-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1735 pmol/kg | 219 | Minutes | 13140 | Lyd pig plasma protease | ELISA | Lyd pig plasma | In Vivo | None | US 201615754395 A | N.A. | ||
| US 201615754395 A | 2022 | Example 31 | 51 | Free | B29R, desB30 modification | Cyclic (C7-C12 disulfide bond in A chain) | L | A22K(N(eps)hexadecanedioyl-gGlu-2×OEG), B3E, B27E, B28E modifications, A and B chain linked with disulfide bond | Insulin Derivative | Antidiabetes | Plasma collected at time points 0,3,7,15,30,60,120,180 Minutes After Dosing | 25 nmol/kg | 79 | Minutes | 4740 | SD rats plasma protease | LC-MS | SD rats plasma with 3 Zn/Hexamer Of Insulin Derivative | In Vivo | None | US 201615754395 A | hIGF1R 0.1% HSA (% rel to HI) Ex48 = 55 | ||
| 35177945 | 2022 | P26 | 12 | N-Acetylated Arg2 | Free | Linear | Mix | D-Leu, D-ala = l and a, Proline side chain linked with (4Br-Phe) at C terminus | Apelin Analog | Diuretic and Cardiovascular effects | Incubated at 37°C for various times, from T0 to T4 h | 5 μM | 86 | Minutes | 5160 | Mouse plasma protease | LC-MS | Mouse plasma | In Vitro | https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/ | None | Ki(nM) = 2.11 ± 0.40 | ||
| 35177945 | 2022 | Apelin-13 | 13 | Free | Free | Linear | L | None | Secreted by White Adipose Tissue (Wat) in both humans and animals | Antidiabetes, Anorexic Effects | N.A. | N.A. | 2.1 | Hours | 7560 | Mouse plasma protease | RP-HPLC | Mouse plasma | In Vitro | https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/ | None | EC50 = 7.4 x 10⁻⁹ M | ||
| 35177945 | 2022 | Lys8GluPAL(Tyr13)apelin-13 | 13 | Free | Tyr13 modifcation, carboxylation | Linear | L | I125 radioactive labeled | Apelin-13 Analogue | Antidiabetes, Anorexic Effects | Blood (20 microliter) collected at 0, 15, 30, 45, 60, 90, 120, 240, 480, 960 and 1440 min after injection | 4.1 nmol/kg | 2.5 - 3 | Hours | 9000 | NIH swiss mice plasma protease | RP-HPLC | NIH swiss mice plasma | In Vivo | https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/ | None | EC50 = 1.1 x 10⁻⁹ M | ||
| 35177945 | 2022 | (pGlu)apelin-13 | 13 | pGlu = Pyroglutamate | Amidation | Linear | L | None | Apelin-13 Analogue | Insulinotrophic activity | 0, 2, 4, 8, 24 h | 20 μg | 3.8 | Hours | 13680 | Mouse plasma protease | RP-HPLC | Mouse plasma in the presence of 50 Mmol/L TEA-HCl Buffer | In Vitro | https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/ | None | EC50(M) = 1.10e-008 (In vitro insulin secretion) | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (LysB29) | 50 | Free | K29(B) Maleimide modified linked using linker C3 (N-[β-maleimidopropyloxy] succinimide ester, BMPS) with chondroitin [CH] | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 3.4 | Hours | 12240 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 2.48 | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (LysB29) | 50 | Free | K29(B) Maleimide modified linked using linker C3 (N-[β-maleimidopropyloxy] succinimide ester, BMPS) with chondroitin [CH] | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 4.4 | Hours | 15840 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 2.48 | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (LysB29) | 50 | Free | K29(B) Maleimide modified linked using linker C6 (N-[ε-maleimidocaproyloxy] sulfosuccinimide ester, EMCS) with chondroitin [CH] | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 2.2 | Hours | 7920 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 1.52 | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (LysB29) | 50 | Free | K29(B) Maleimide modified linked using linker C6 (N-[ε-maleimidocaproyloxy] sulfosuccinimide ester, EMCS) with chondroitin [CH] | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 2.8 | Hours | 10080 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 1.52 | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (GlyA1) | 50 | Gly1(A) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH] | Free | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 4.8 | Hours | 17280 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 11.01 | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (LysB29) | 50 | Free | K29(B) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH] | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 4.9 | Hours | 17640 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 1.29 | ||
| 35259149 | 2022 | CH-/HPN-Conjugated Insulins (LysB29) | 50 | Free | K29(B) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH] | Cyclic (C6-C11 disulfide bond in A chain) | L | C7-C7 and C20-C19 disulfide bond between A and B chain | Human insulin analog | Antidiabetes | Blood samples were collected immediately before injection and at various time points up to 48 h after injection | 340 nmol/kg | 4.4 | Hours | 15840 | Mice serum protease | Sandwich ELISA | Mice serum | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | EC50(nM) = 1.29 | ||
| 35259149 | 2022 | TP5-MA | 5 | Free | Free | Linear | L | Conjugating a myristic acid-acylated lysine to a permissive site of TP5, Radiolabeling C14 at Lys2 | Myristic Acid-Modified Tp5 | Treatment Of Patients With Immunodeficiency Diseases, Such As Rheumatoid Arthritis, Cancers, Hepatitis B Virus Infection, And Acquired Immunodeficiency Syndrome (Aids) | One hundred microliter plasma samples were collected at the following time intervals: 0.5, 5, 10, 20, 30, and 45 min and 1, 2, 3, 4, 6, 8,and 10 h after peptide administration. | 1 mg/kg | 1.75 ± 0.72 | Hours | 6300 | Wistar rats plasma protease | LC-MS/MS | Wistar rats plasma | In Vivo | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | The cytotoxicity of TP5-MA was evaluated in mice spleen lymphocytes. Cytotoxicity was not detected after treatment with different concentrations of TP5-MA and TP5 | ||
| 35259149 | 2022 | TP5-MA | 5 | Free | Free | Linear | L | Conjugating a myristic acid-acylated lysine to a permissive site of TP5, Radiolabeling C14 at Lys2 | Myristic Acid-Modified Tp5 | Treatment Of Patients With Immunodeficiency Diseases, Such As Rheumatoid Arthritis, Cancers, Hepatitis B Virus Infection, And Acquired Immunodeficiency Syndrome (Aids) | 37 °C | N.A. | 4.42 | Hours | 15912 | Human plasma protease | LC-MS/MS | 1 mg/mL human plasma | In Vitro | https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/ | None | The cytotoxicity of TP5-MA was evaluated in mice spleen lymphocytes. Cytotoxicity was not detected after treatment with different concentrations of TP5-MA and TP5 | ||
| 35807558 | 2022 | PYY3-36 | 34 | Free | Free | Linear | L | None | Neuropeptide Y | Antidiabetes, Antiobesity | The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min) | 1 μM | 200 | Minutes | 12000 | Minipigs plasma protease | LC-MS | Minipigs plasma | In Vitro | https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/ | None | Ki(nM) = 40 (In Vitro Binding of Peptide Analogues against Human Y1 receptor) | ||
| 35807558 | 2022 | PYY3−36 (methylamide) | 34 | Free | Methyl amide addition at C terminus | Linear | L | None | PYY analogue | Antidiabetes, Antiobesity | The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min) | 1 μM | 200 | Minutes | 12000 | Minipigs plasma protease | LC-MS | Minipigs plasma | In Vitro | https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/ | None | Ki(nM) = >10,000 (In Vitro Binding of Peptide Analogues against Human Y1 receptor) | ||
| 35807558 | 2022 | [MeArg33]PYY3−36 | 34 | Free | Methylated Arg33 at C terminus | Linear | L | Methylated Arg33 | PYY analogue | Antidiabetes, Antiobesity | The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min) | 1 μM | 200 | Minutes | 12000 | Minipigs plasma protease | LC-MS | Minipigs plasma | In Vitro | https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/ | None | Ki(nM) = 2500 (In Vitro Binding of Peptide Analogues against Human Y1 receptor) | ||
| 35807558 | 2022 | [β-homoArg33]PYY3−36 | 34 | Free | β-homoArg33 at C terminus | Linear | L | β-homoArg33 modification | PYY analogue | Antidiabetes, Antiobesity | The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min) | 1 μM | 230 | Minutes | 13800 | Minipigs plasma protease | LC-MS | Minipigs plasma | In Vitro | https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/ | None | Ki(nM) = 200 (In Vitro Binding of Peptide Analogues against Human Y1 receptor) | ||
| 35059568 | 2021 | PMX53 | 6 | Acetylation | Free | Cyclic(Orn-Arg N-C bond) | Mix | cha4 = D-cyclohexylalanine, O2 = Ornithine | Peptidomimetic C5a receptor antagonists | C5Ar1 Antagonists | Serial blood samples were collected at 10, 15, 30, 45, and 60 min, and at 2, 4, 6, and 24 h via a tail vein | 1 mg/kg | 1.3 (Elimination Half Life) | Hours | 4680 | Mice plasma protease | LC-MS | Mice plasma | In Vivo | None | None | The inhibition of TNF levels also presented a similar median effective concentration (EC50) for JPE-1375 (4.5 μM) | ||
| 35011324 | 2021 | AWRK6 | 18 | Free | Free | Linear | L | None | Based on the natural occurring peptide dybowskin-2CDYa | Antimicrobial | Blood samples were collected from orbital venous plexus at 0.083, 0.167, 0.25, 0.5, 1, 1.5, 2, 3, 4, 6, 8, and 10 h | 2.35 mg/kg | 2.946 ± 2.048 | Hours | 10605.6 | SPF-grade male SD rats plasma protease | LC-MS/MS | SPF-grade male SD rats plasma | In Vivo | None | None | N.A. | ||
| 35011324 | 2021 | AWRK6 | 18 | Free | Free | Linear | L | None | Based on the natural occurring peptide dybowskin-2CDYa | Antimicrobial | Blood samples were collected from orbital venous plexus at 0.083, 0.167, 0.25, 0.5, 1, 1.5, 2, 3, 4, 6, 8, and 10 h | 4.7 mg/kg | 2.941 ± 1.399 | Hours | 10587.6 | SPF-grade male SD rats plasma protease | LC-MS/MS | SPF-grade male SD rats plasma | In Vivo | None | None | N.A. | ||
| 35011324 | 2021 | AWRK6 | 18 | Free | Free | Linear | L | None | Based on the natural occurring peptide dybowskin-2CDYa | Antimicrobial | Blood samples were collected from orbital venous plexus at 0.083, 0.167, 0.25, 0.5, 1, 1.5, 2, 3, 4, 6, 8, and 10 h | 9.4 mg/kg | 2.781 ± 1.021 | Hours | 10011.6 | SPF-grade male SD rats plasma protease | LC-MS/MS | SPF-grade male SD rats plasma | In Vivo | None | None | N.A. | ||
| 35011324 | 2021 | AWRK6 | 18 | Free | Free | Linear | L | None | Based on the natural occurring peptide dybowskin-2CDYa | Antimicrobial | Blood samples were collected from orbital venous plexus at 0.083, 0.167, 0.25, 0.5, 1, 1.5, 2, 3, 4, 6, 8, and 10 h | 4.7 mg/kg | 1.983 ± 0.583 | Hours | 7138.8 | SPF-grade male SD rats plasma protease | LC-MS/MS | SPF-grade male SD rats plasma | In Vivo | None | None | N.A. | ||
| 34707178 | 2021 | PYY3-36 analogues 34 | 34 | Free | Amidation | Linear | L | Fatty acid conjugation at position 30 | Derived from PYY | Antiobesity | N.A. | 15 nmol/kg | 4 | Hours | 14400 | Male göttingen minipigs plasma protease | LC-MS | Male göttingen minipigs plasma | In Vivo | None | None | N.A. | ||
| 34707178 | 2021 | PYY3-36 analogues 37 | 34 | Free | Amidation | Linear | L | Fatty acid conjugation at position 30 | Derived from PYY | Antiobesity | N.A. | 15 nmol/kg | 2 | Hours | 7200 | Male göttingen minipigs plasma protease | LC-MS | Male göttingen minipigs plasma | In Vivo | None | None | N.A. | ||
| 34707178 | 2021 | PYY3-36 analogues 38 | 34 | Free | Amidation | Linear | L | Fatty acid conjugation at position 30 | Derived from PYY | Antiobesity | N.A. | 15 nmol/kg | 4 | Hours | 14400 | Male göttingen minipigs plasma protease | LC-MS | Male göttingen minipigs plasma | In Vivo | None | None | N.A. | ||
| 34630378 | 2021 | ABD-VP1 | 330 | ABD | Free | Linear | L | None | Synthetic | Treatment of Coxsackievirus B3 (Cvb3)-Induced Viral Myocarditis | 1h at RT | 0.25 μg/μL | 280 | Minutes | 16800 | Murine serum protease | ELISA | Murine serum | In Vivo | None | None | ABD-VP1 increased the 28-day survival rate from about 40% (VP1) to 73% | ||
| 34506138 | 2021 | α/sulfono-γ-AApeptide hybrid analogue 15 | 35 | Free | Amidation | Linear | L | Substitution of L-serine at position 2 with α-aminoisobutyric acid (Aib), X1 = Structure given in paper | α/Sulfono-γ-AApeptide Hybrid Analogues of Glucagon | Regulating glucose homeostasis | blood samples were obtained at 15 min, 30 min, 1 h, 2 h, 4 h, 8 h, and 24 h after injection | 5 mg/kg | ~4 | Hours | 14400 | C57Bl/6J female mice plasma protease | LC-MS/MS | C57BL/6J female mice plasma | In Vivo | None | None | EC50 (nM) = 0.86 (Bioactivity of α/Sulfono-γ-AApeptide Hybrid Analogues in Cre Luc Production Functional Assay) | ||
| 34402197 | 2021 | Teduglutide | 33 | Free | Free | Linear | L | None | GLP-2 analogue | Treatment of Short Bowel Syndrome | N.A. | 0.05 mg/kg | 1.1 | Hours | 3960 | Human plasma protease | N.A. | Human adult plasma (in Japanese patients with SBS) | In Vivo | DB id: DB08900 | None | N.A. | ||
| 34402197 | 2021 | Teduglutide | 33 | Free | Free | Linear | L | None | GLP-2 analogue | Treatment of Short Bowel Syndrome | N.A. | 0.05 mg/kg | 1.24 | Hours | 4464 | Human plasma protease | N.A. | Human adult plasma (in Non-Japanese patients with SBS) | In Vivo | DB id: DB08900 | None | N.A. | ||
| 34393794 | 2021 | LIT01-196 | 17 | Fluorocarbon chain (CF3(CF2)7(CH2)2C(O)) attached to the N-terminal part of K17F | Free | Linear | L | None | Apelin-17 Analog | Treatment of Hypertension | N.A. | 15 nmol/kg | 156 | Minutes | 9360 | Rats plasma protease | RIA | Rats plasma | In Vivo | Pubchem CID Apelin: 56841713 | None | IC50 = 0.56 ± 0.04 nmol/l for LIT01-196 | ||
| 34358122 | 2021 | AT1-HSA-MRN-NPs | 12 | Free | HSA linked through PEG4 | Linear | L | None | Synthetic | Treatment of Cardiovascular Disease | Blood was collected from the jugular vein at the following timepoints: 0, 5, 15, 30, 45, 60, 120, and 360 min | 50 μg/kg | 101.3 | Minutes | 6078 | Rats plasma protease | HPLC | Rats plasma | In Vivo | None | None | N.A. | ||
| 34048741 | 2021 | M4 | 40 | Free | Cys addition at C terminal | Linear | L | M, R amino acid substitutions | Synthetic | Antidiabetes | Blood samples were collected from the lateral tail vein at 0, 0.083, 0.25, 0.5, 1, 2, 3, 4, 6, 8 and 10 h | 0.07 mg/kg | 1.80 ± 0.23 | Hours | 6480 | Male SD rats plasma protease | ELISA | Male SD rats plasma | In Vivo | None | None | EC50(nM) = 38.49 ± 4.58 (EC50 values represent the concentration (nM) of agonists to simulate half-maximum GLP-1 receptor cAMP activation) | ||
| 33918853 | 2021 | HFn/DOX | 172 | Free | Free | Linear | L | None | Synthetic | Antitumor | Blood samples were collected from the retro orbital sinus at fixed time points (10, 30 min, 1, 2, 4, 8, 12, 24, 36, 48 h) at 37 °C | 3.0 mg/kg | 3.07 ± 0.06 | Hours | 11052 | SD rats serum protease | Fluorescence spectrometry | SD rats serum | In Vivo | PDB id: 3AJO | None | IC50 (μg mL−1) = 0.49 ± 0.11 | ||
| 33825469 | 2021 | FITC-labeled Ex4−DNP 9 | 44 | FITC-Ahx | Ex4 linked to DNP9 = Dinitro phenol by (PEG)n spacer | Linear | L | None | GLP-1 analogs | Antidiabetes | Blood sample (20 μL) was obtained from the leg veins and using a pipette added into 80 μL of PBS solution (containing EDTA) at 40 s, 25 min, 50 min, 1.2 h, 1.6 h, 2 h, 4.8 h, 6.5 h, 8.5 h, 10 h, and 24 h after injection. | 75 nmol/kg | 2.07 ± 0.05 | Hours | 7452 | C57Bl/6 mice plasma protease | Fluorescence assay | C57BL/6 mice plasma | In Vivo | None | None | EC50 values = 0.99 nM for Ex4 (GLP-1 Receptor Activation Potency) | ||
| 33825469 | 2021 | FITC-labeled Ex4−DNP 10 | 44 | FITC-Ahx | Ex4 linked to DNP10 = Dinitro phenol by (PEG)n spacer | Linear | L | None | GLP-1 analogs | Antidiabetes | Blood sample (20 μL) was obtained from the leg veins and using a pipette added into 80 μL of PBS solution (containing EDTA) at 40 s, 25 min, 50 min, 1.2 h, 1.6 h, 2 h, 4.8 h, 6.5 h, 8.5 h, 10 h, and 24 h after injection. | 75 nmol/kg | 3.55 ± 0.33 | Hours | 12780 | C57Bl/6 mice plasma protease | Fluorescence assay | C57BL/6 mice plasma | In Vivo | None | None | EC50 values = 0.99 nM for Ex4 (GLP-1 Receptor Activation Potency) | ||
| 33825469 | 2021 | FITC-labeled Ex4−DNP 11 | 44 | FITC-Ahx | Ex4 linked to DNP11 = Dinitro phenol by (PEG)n spacer | Linear | L | None | GLP-1 analogs | Antidiabetes | Blood sample (20 μL) was obtained from the leg veins and using a pipette added into 80 μL of PBS solution (containing EDTA) at 40 s, 25 min, 50 min, 1.2 h, 1.6 h, 2 h, 4.8 h, 6.5 h, 8.5 h, 10 h, and 24 h after injection. | 75 nmol/kg | 2.62 ± 0.17 | Hours | 9432 | C57Bl/6 mice plasma protease | Fluorescence assay | C57BL/6 mice plasma | In Vivo | None | None | EC50 values = 0.99 nM for Ex4 (GLP-1 Receptor Activation Potency) | ||
| 33791863 | 2021 | 125I-Ang Conj. | 7 | Thiol bisphosphonate,Maleimidopropionyl,PEG conjugated at N terminus | Free | Linear | L | 125I labeled | Synthetic | Role in Renal and Cardiovascular Homeostasis | Blood samples (∼200 µL) were collected from the cannula into heparinized tubes before dosing and 5, 10, 15, 30, and 45 min and 1, 1.5, 2, and 3 h after administration | 4.5 mM | 3.4 | Hours | 12240 | Rats plasma protease | Radioactivity assay | Rats plasma | In Vivo | None | None | Ang Conj. values were 20.4±0.5%,6.8±0.6%, 8.4±0.2%, and 11.6±0.2% | ||
| 33672039 | 2021 | GLP1_8G37C-HSA | 31 | Free | HSA | Linear | L | Substituition of amino acid G at position 2 | GLP-1 analogs | Antidiabetes | Blood samples (<70 μL) were collected from the retroorbital venous sinus at 0.16, 1, 3, 6, 12, and 24 h after conjugate administration | 10 nmol/kg | 3.2 (T1/2a) | Hours | 11520 | BALB/c mice plasma protease | Sandwich ELISA | BALB/c mice plasma | In Vivo | None | None | EC50= 1340 nM ( In vitro measurement of cAMP production by GLP-1R-overexpressing HEK-293 cells) | ||
| 33672039 | 2021 | GLP1_8A37C-HSA | 30 | Free | HSA | Linear | L | Substituition of amino acid A at position 2 | GLP-1 analogs | Antidiabetes | Blood samples (<70 μL) were collected from the retroorbital venous sinus at 0.16, 1, 3, 6, 12, and 24 h after conjugate administration | 10 nmol/kg | 3.3 (T1/2a) | Hours | 11880 | BALB/c mice plasma protease | Sandwich ELISA | BALB/c mice plasma | In Vivo | None | None | EC50=185 nM ( In vitro measurement of cAMP production by GLP-1R-overexpressing HEK-293 cells) | ||
| 33665501 | 2021 | PLG-Pt | None | Free | Cisplatin (CDDP) is complexed with the carboxyl groups of the L-glutamic acid | Linear | L | None | Synthetic | Anticancer | At predefined time points 5, 15, and 30 min, and 1, 3, 6, 12, and 24 h, 200.0 μL of blood samples were collected from the orbital cavities of rats | 3 mg/kg | 1.9 | Hours | 6840 | Rats plasma protease | ICP-MS | Rats plasma | In Vivo | None | None | IC50 (μg mL−1) = 4.8 in SKOV3 cells | ||
| 33656323 | 2021 | B6 | 146 | Free | Lys146 contains Fatty acid moiety which introduces 8-amino-3,6-dioxaoctanoic acid (AEEA) and glutamic acid | Cyclic (C57-C104 Disulfide Bond) In IL-2 | L | None | Synthetic | Anticancer, Autoimmune diseases treatment | Serum samples were collected at 10 min and 2, 6, 12, 20, and 36 h for group I and 1, 4, 8, 16, 24, and 48 h for group II by retro-orbital bleeding, . Serum samples were collected at 0, 2, 5, 20, 30, and 45 min for group I and 10 min and 1, 2, 4, 6, and 8 h for group II by retro-orbital bleeding | 0.6 mg/kg | 3.595 ± 0.518(T1/2b) | Hours | 12942 | Mouse plasma protease | Sandwich ELISA | Mouse plasma | In Vivo | pdb id: 5LQB and https://pubs.acs.org/doi/suppl/10.1021/acs.bioconjchem.1c00062/suppl_file/bc1c00062_si_001.pdf | None | KD (M) = (1.952 ± 0.130) × 10−8 for IL-2 | ||
| 33607165 | 2021 | JMV5206 | 6 | Free | substitution of Leu13 by the (L)-(Trimethylsilyl)-Alanine (TMSAla) | Linear | L | Arg8-Arg9 was replaced by a reduced amine bond (Ψ[CH2NH]) between Lys8-Lys9 | Derived from NT | Analgesic without hypothermia | Plasma collected at 0, 1, 2, 5, 10, 30 and 60 min | 0.156 mM | 2.13 ± 0.19 | Hours | 7668 | Rats plasma protease | UPLC-MS | Rats plasma | In Vivo | None | None | (Binding) Ki (nM) = 2.45 ± 0.17 for hNTS1 | ||
| 33555858 | 2021 | B10-33 (Cpd 58) | 24 | Acetylation | Amidation | Linear | L | Lys24 conjugated with(-(γE)3-C16), Aib | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected from individual animals at the following time points: 0.083, 0.25, 0.5, 1, 3, 6, 8, 24, 48, and 72 h | 1 mg/kg | 4.3 | Hours | 15480 | Rats plasma protease | LCHRMS | Rats plasma | In Vivo | None | None | EC50 nM = 17.6 ± 8.1(97%) in OVCAR5 cells | ||
| 33555858 | 2021 | Cpd 61(B10-33 ) | 24 | Acetylation | Amidation | Linear | L | Lys24 conjugated with (-(γE)3-C18), PEGylation,Aib,Nle | Synthetic | Treatment of Cardiovascular Diseases | N.A. | 1 mg/kg | 4.8 | Hours | 17280 | Rats plasma protease | LCHRMS | Rats plasma | In Vivo | None | None | EC50 nM = 1.0 ± 0.9 (79%) in OVCAR5 cells | ||
| 33555858 | 2021 | Cpd 62(B10-33 ) | 24 | Acetylation | Amidation | Linear | L | Lys24 conjugated with (-(γE)3-C18), PEGylation,Aib,Nle,acetylation at Lys10 and Lys23 | Synthetic | Treatment of Cardiovascular Diseases | N.A. | 1 mg/kg | 4.3 | Hours | 15480 | Rats plasma protease | LCHRMS | Rats plasma | In Vivo | None | None | EC50 nM = 0.6 ± 0.4 (95%) in OVCAR5 cells | ||
| 33555858 | 2021 | Cpd 64(B10-33 ) | 24 | Acetylation | Amidation | Linear | L | Lys24 conjugated with (-(PEG2)3-(γE)3-C18), PEGylation,Aib,Nle,acetylation at Lys10 and Lys23 | Synthetic | Treatment of Cardiovascular Diseases | N.A. | 1 mg/kg | 3.9 | Hours | 14040 | Rats plasma protease | LCHRMS | Rats plasma | In Vivo | None | None | EC50 nM = 0.2 ± 0.1 (89%) in OVCAR5 cells | ||
| 33555858 | 2021 | Cpd 65(B10-33 ) | 24 | Acetylation | Amidation | Linear | L | Lys24 conjugated with (-(γE)3-C18), PEGylation,Aib,Nle,acetylation at Lys10 and Lys23 | Synthetic | Treatment of Cardiovascular Diseases | N.A. | 1 mg/kg | 3.4 | Hours | 12240 | Rats plasma protease | LCHRMS | Rats plasma | In Vivo | None | None | EC50 nM = 0.1 ± 0.1 (88%) in OVCAR5 cells | ||
| 33555858 | 2021 | Cpd 66(B10-33 ) | 24 | Acetylation | Amidation | Linear | L | Lys24 conjugated with (-(γE)3-C18), PEGylation,Aib,Nle,acetylation at Lys10 and Lys23 | Synthetic | Treatment of Cardiovascular Diseases | N.A. | 1 mg/kg | 3.96 | Hours | 14256 | Rats plasma protease | LCHRMS | Rats plasma | In Vivo | None | None | EC50 nM = 0.4 ± 0.2 (88%) in OVCAR5 cells | ||
| 33387593 | 2021 | GMOP-IFN | 179 | GM-CSF O-glycosylated Peptide | Free | Linear | L | None | Synthetic | Antiviral, Antiproliferative | Blood samples were taken at different times post-injection | 100000 U | 3.0 ± 0.4(T1/2 Elimination) | Hours | 10800 | Rats plasma protease | Sandwich ELISA | Rats plasma | In Vivo | PDB id: 1ITF | None | Antiviral SBA (IU/ng) = 190 ± 30 in GMOP-IFN, Antiproliferative SBA (IU/ng) = 280 ± 40 | ||
| 33387593 | 2021 | mGMOP-IFN | 180 | Modified GOMP | Free | Linear | L | None | Synthetic | Antiviral, Antiproliferative | Blood samples were taken at different times post-injection | 100000 U | 2.5 ± 0.2 (T1/2 Elimination) | Hours | 9000 | Rats plasma protease | Sandwich ELISA | Rats plasma | In Vivo | PDB id: 1ITF | None | Antiviral SBA (IU/ng) = 280 ± 50 in mGMOP-IFN, Antiproliferative SBA (IU/ng = 95 ± 5 | ||
| 33245951 | 2021 | GIP(1–42) | 42 | Free | Free | Linear | L | None | Secreted by entero-endocrine K cells located in the proximal intestine | Insulinotrophic Effect | Blood samples (50 μL) were drawn from the retro-orbital plexus at t = 0, 1, 3, 5, 10 and 20 min | 25 nmol/kg | 93 ± 2 | Seconds | 5580 | Mouse plasma protease | RIA | Mouse plasma | In Vivo | https://pdf.sciencedirectassets.com/271102/1-s2.0-S0014579300X09702/1-s2.0-0014579381802888/main.pdf?X-Amz-Security-Token=IQoJb3JpZ2luX2VjEIr%2F%2F%2F%2F%2F%2F%2F%2F%2F%2FwEaCXVzLWVhc3QtMSJHMEUCIQD62SR4A%2B4hs8dyDimRd8i4eqjFdUt5lDROOjPQfQfVdAIgCzazhyIQYpOf0Ptr2TaxQcJ0gfc0tFJSvp00rqp72KMqsgUIExAFGgwwNTkwMDM1NDY4NjUiDFKOQuOPiilKRo0IGiqPBYnEsqS8aZVPDGyG07f6LcX2zV6C1BU1jQ%2BiYzudplRLnaMGn2dzKqD0IgA3jsmhp7CPygQevWTs4Ed1E%2FEvWjuhN8AOvlXEs2Af0t7zL6%2Ba6LtjwN7ZRUIgQGtEhxXKjkWXm9SbXNXu%2FW%2B0ZCHb36rhKfxxcw6e3m0TTTQ5VBU5YtjFRc9KPiAZsUvrVg42y6wbkYdoImtbRueY2e67MmEBizqQ12ayvDeaiudwbYmOGBGr%2BGvimIbEui5OYl1NgebT3Q8%2F%2F5MQ6z0bJxhTQQvplmdG7ymlRrCWfaYdi6ama4%2FpLbZKNVGuU9hscZNpcQUayR82zK3CBh9HRLr%2BTXe6OyFGBRn56BpJ1b%2Bh7qQZYMWBDZGMQdNungv743HpUHMuIxKAt3%2B8SEJ1WkfsIsptsTXEJ%2Fe5Pe2WTSkejT7b9WNpvYncidJCF2lT8NW9RfAw8mc7boYYiFuzqfjULjJV2W6KiXDtf%2F3yQmIV8VRa6hHVovZEQlYpMNpkWgqXznwKL5Lf%2FVUx09SOMK8MoHIWUbF8kgKRM9zGxSs3lPKU7g5gnTqcLwgUKBTnYjjS%2Bm0kz5A4Y4PRE0NI5L4Uy4iF0moVtD6fcXJ7uceU5ofMjnk4jTbla86W0LkLEI6VxBLN2vyWJ%2BkiKXE0GmT7xerhOiY%2FJt74ImPgZVDf6nKzoNAKgoEW5yIBW8X8eRQhNQgbPrCSTSwcAW%2BCoULg4xS3aG87frYuj3ZSUb1DOHzkIRq5G9yj7EjgVbroxu2hh3g9YytLb2PpbvOVSTe%2B%2F2zm04ZibPDOd9UEZQPhgDMGQLnEQ0oKpHU3xaThRzRdTnF%2B6Va%2F7nTk9HXfj3MLfKH3vRbkHVcuODJZVomDO2Awq9mnuQY6sQFg6uBpRDSJbdGuJM4MBWHMJAuiWcghOQq8RAfYeWwCKcdeeLjIPYYpXygg22s0S36%2BiClhIk6QXuPZWihQ%2BbG2PEAcUOIXqLpPHTWwmjGIGrKcTPHPEJKRYKb6HCmW5yCqSEXiKCKgJXX2OzfABfGdtJxraYtj94rVu3tUZ2J1%2Bp4icKKPMKSJaHNBTuKzqNmpvnDyVRDiT0L2iJhacy9SB9TOXT9U0gMzOfOZeQk%2Famo%3D&X-Amz-Algorithm=AWS4-HMAC-SHA256&X-Amz-Date=20241105T104258Z&X-Amz-SignedHeaders=host&X-Amz-Expires=300&X-Amz-Credential=ASIAQ3PHCVTY7EKIR4FY%2F20241105%2Fus-east-1%2Fs3%2Faws4_request&X-Amz-Signature=da086866fd5ae7aa1850a8ed33269fdcc94d601135b6ec16e293756e1d2b3045&hash=fbb1651e9188cb1c761d3e5215af03584aadf82583c0ccbb7e874e4504a450ee&host=68042c943591013ac2b2430a89b270f6af2c76d8dfd086a07176afe7c76c2c61&pii=0014579381802888&tid=spdf-dbd1ce2d-f820-4e78-8534-eac97584de70&sid=5ffdcf685136184f4559b673ec8c38454df3gxrqb&type= | None | N.A. | ||
| 33129837 | 2021 | OM19r-8 | 19 | Free | Amidation | Linear | Mix | replacing L-Arg15,19 with D-Arg15,19 | Derived from the antibacterial peptide OM19R | Antibacterial | Aliquots were analyzed after 0, 20, 30, 40, 60, 80, 90, 100, 120, 150, 180, 210, 240, 175 and 270min | 31.5 μmol/L | 71.10 ± 3.43 | Minutes | 4266 | Wistar rats blood plasma protease | HPLC | Wistar rats blood plasma | In Vitro | None | None | MIC(μM) = 1 for OM19r -8 in E. coli ATCC25922, OM19r-8 and 250 mPEG5-OM19r-8 showed no cytotoxicity at the concentration up to 32 µM, hemolytic activity of OM19r-8 and mPEG5-OM19r-8 was < 10% at the determined concentration (1-128 μM), which was obviously superior to the control peptide melittin | ||
| 33129837 | 2021 | mPEG5- OM19r-8 | 19 | mPEG5 | Amidation | Linear | Mix | replacing L-Arg15,19 with D-Arg15,19 | Derived from the antibacterial peptide OM19R | Antibacterial | Aliquots were analyzed after 0, 20, 30, 40, 60, 80, 90, 100, 120, 150, 180, 210, 240, 270, 300, 400, 600 and 1000min | 31.5 μmol/L | 242.44 ± 39.21 | Minutes | 14546.4 | Wistar rats blood plasma protease | HPLC | Wistar rats blood plasma | In Vitro | None | None | MIC(μM) = 1 for OM19r -8 in E. coli ATCC25922, OM19r-8 and 250 mPEG5-OM19r-8 showed no cytotoxicity at the concentration up to 32 µM, hemolytic activity of OM19r-8 and mPEG5-OM19r-8 was < 10% at the determined concentration (1-128 μM), which was obviously superior to the control peptide melittin | ||
| 32078672 | 2020 | rFVIIIFc | 865 | Free | IgG1 Fc | Linear | L | None | Synthetic | Role In Clotting | N.A. | 200 IU/kg | 1.85 | Hours | 6660 | DKO mice plasma protease | chromogenic activity assays | DKO mice plasma | In Vivo | PDB id : 5K8D, https://pmc.ncbi.nlm.nih.gov/articles/instance/7180082/bin/bloodBLD2019001292-suppl1.pdf | None | ED50 values for BIVV001 (7.5 IU/kg) and rFVIII (7.9 IU/kg) were similar | ||
| 33310780 | 2020 | NYBSP-4 | 34 | Acetylation | Amidation | Linear | L | 2-(7-octenyl)alanine-2-(4-pentenyl)alanine modifications | Derived from ACE2 | Antiviral | 0, 10, 30, 60, and 120 min | 1mM | >289 | Minutes | 17340 | Human plasma protease | LC-MS/MS | Human plasma | In Vitro | None | None | IC50 = 1.97 ± 0.14 μM in HT1080/ACE2 cells | ||
| 33310780 | 2020 | NYBSP-C | 30 | Acetylation | Amidation | Linear | L | None | Derived from ACE2 | Antiviral | 0, 10, 30, 60, and 120 min | 1 mM | >289 | Minutes | 17340 | Human plasma protease | LC-MS/MS | Human plasma | In Vitro | None | None | IC50 >27.7 μM in HT1080/ACE2 cells | ||
| 33284103 | 2020 | Mouse ucOCN | 46 | Free | Free | Cyclic (C19-C25 Disulfide bond) | L | Uncarboxylation at all glutamic acid | Osteoblast Derived hormone | Antidiabetes | 0 to 5 hr at 37°C | 100 ng/mL | ~120 | Minutes | 7200 | Mouse plasma protease | ELISA | Mouse plasma | In Vitro | None | None | N.A. | ||
| 33284103 | 2020 | Mouse O-glycosylated ucOCN | 46 | Free | Free | Cyclic (C19-C25 Disulfide bond) | L | O-glycosylation likely at Ser8 in SVPSPDP, Uncarboxylation at all glutamic acid | Osteoblast Derived hormone | Antidiabetes | 0 to 5 hr at 37°C | 100 ng/mL | >5 | Hours | 18000 | Mouse plasma protease | ELISA | Mouse plasma | In Vitro | None | None | N.A. | ||
| 33284103 | 2020 | Mouse O-glycosylated ucOCN | 46 | Free | Free | Cyclic (C19-C25 Disulfide bond) | L | O-glycosylation likely at Ser8 in SVPSPDP, Uncarboxylation at all glutamic acid | Osteoblast Derived hormone | Antidiabetes | 2 hours at 37°C | 40 ng/g | ~182 | Minutes | 10920 | Mice serum protease | OCN ELISA | Mice serum | In Vivo | None | None | N.A. | ||
| 33284103 | 2020 | Mouse ucOCN | 46 | Free | Free | Cyclic (C19-C25 Disulfide bond) | L | Uncarboxylation at all glutamic acid | Osteoblast Derived hormone | Antidiabetes | 2 hours at 37°C | 40 ng/g | ~108 | Minutes | 6480 | Mice serum protease | OCN ELISA | Mice serum | In Vivo | None | None | N.A. | ||
| 33125843 | 2020 | 5a | 45 | Free | Either or nonsulfated gastrin-6 were coupled to the C-terminus of 2d and 2k through two OEG spacers, affording 5a−5d | Linear | L | Aib substiuition at position 2, Ser39 linked with fatty acid | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 8, 16, and 24 h, blood samples (~100 μL) were collected from fundus venous plexus | 50 nmol/kg | 1.7 | Hours | 6120 | SD rats plasma protease | LC−MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 0.040 ± 0.011 (Effects of 5a on GLP-1R) | ||
| 33125843 | 2020 | 5b | 45 | Free | Either or nonsulfated gastrin-6 were coupled to the C-terminus of 2d and 2k through two OEG spacers, affording 5a−5d | Linear | L | Aib substiuition at position 2,Ser39 linked with fatty acid | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 8, 16, and 24 h, blood samples (~100 μL) were collected from fundus venous plexus | 50 nmol/kg | 1.9 | Hours | 6840 | SD rats plasma protease | LC−MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 0.048 ± 0.018 (Effects of 5b on GLP-1R) | ||
| 33125843 | 2020 | 6a | 45 | Free | 4c, 4d, 4m, and 4n were next C-terminally modified with the sequence Tyr-Gly-Trp-Leu-Asp-Phe-NH2 using two OEGs as the linker to generate 6a−6d | Linear | L | C1 = structure given in paper, Aib substiuition at position 2,Ser39 linked with fatty acid | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 8, 16, and 24 h, blood samples (~100 μL) were collected from fundus venous plexus | 50 nmol/kg | 4.6 | Hours | 16560 | SD rats plasma protease | LC−MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 0.022 ± 0.008 (Effects of 6a on GLP-1R) | ||
| 33125843 | 2020 | 6b | 45 | Free | 4c, 4d, 4m, and 4n were next C-terminally modified with the sequence Tyr-Gly-Trp-Leu-Asp-Phe-NH2 using two OEGs as the linker to generate 6a−6d | Linear | L | C1 = structure given in paper,Aib substiuition at position 2,Ser39 linked with fatty acid | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 8, 16, and 24 h, blood samples (~100 μL) were collected from fundus venous plexus | 50 nmol/kg | 5 | Hours | 18000 | SD rats plasma protease | LC−MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 0.041 ± 0.017 (Effects of 6b on GLP-1R) | ||
| 33125843 | 2020 | 7a | 45 | Free | 4c, 4d, 4m, and 4n were next C-terminally modified with the sequence Tyr-Gly-Trp-Leu-Asp-Phe-NH2 using two OEGs as the linker to generate 6a−6d | Linear | L | Modification of 6a and 6b with the introduction of C2 = structure given in paper,Aib substiuition at position 2,Ser39 linked with fatty acid | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 8, 16, and 24 h, blood samples (~100 μL) were collected from fundus venous plexus | 50 nmol/kg | 2.9 | Hours | 10440 | SD rats plasma protease | LC−MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 0.041 ± 0.017 (Effects of 6b on GLP-1R) | ||
| 33125843 | 2020 | 7b | 45 | Free | 4c, 4d, 4m, and 4n were next C-terminally modified with the sequence Tyr-Gly-Trp-Leu-Asp-Phe-NH2 using two OEGs as the linker to generate 6a−6d | Linear | L | Modification of 6a and 6b with the introduction of C2 = structure given in paper,Aib substiuition at position 2,Ser39 linked with fatty acid | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 8, 16, and 24 h, blood samples (~100 μL) were collected from fundus venous plexus | 50 nmol/kg | 3.1 | Hours | 11160 | SD rats plasma protease | LC−MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 0.041 ± 0.017 (Effects of 6b on GLP-1R) | ||
| 33057063 | 2020 | NRG1-MFc | 268 | Free | fusion of the C-terminus of NRG1 to the N-terminus of the Fc fragment | Linear | L | None | Synthetic | Her4-Selective Agonism | Overnight at 4 °C | 10 μg/mL | 1.4 | Hours | 5040 | Mouse serum protease | ELISA | Mouse serum | In Vitro | PDB ID: 3U7U | None | HER4 binding KD = 640 nM | ||
| 33057063 | 2020 | ALM6 | 75 | Free | Free | Linear | L | None | Synthetic | Her4-Selective Agonism | Overnight at 4 °C | 10 μg/mL | 1.4 | Hours | 5040 | Mouse serum protease | ELISA | Mouse serum | In Vitro | None | None | HER4 binding KD = 440 nM | ||
| 33008433 | 2020 | Hypoxic-Ischemic Brain Damage Associated Peptide (HIBDAP) | 17 | Free | Free | Linear | L | None | derives from the 210st to 226st amino acids of HSP90AA1 | Involved In The Nod-Like Receptor (Nlr) Signaling Pathway | N.A. | N.A. | 3.5 | Hours | 12600 | Mammalian reticulocytes protease | N.A. | Mammalian reticulocytes with OGD ( oxygen and glucose deprivation (OGD)) | In Vitro | None | None | N.A. | ||
| 32888078 | 2020 | Human Lau-PTEN-PDZ | 8 | N-Lauryl | Free | Linear | L | Lipidation | Synthetic | Treatment of Alzheimer's diseases | Samples (80 μL) were taken at 0, 3, 6,9, 15, 30, 45, 60, 90, 120, 180, 240, 360 and 1440 min | Peptide stock solutions (120 μL) were added to pre-warmed diluted plasma (50% v/v, 1080 μL) | 2.96 | Hours | 10656 | Simulated intestinal fluid protease | HPLC | Simulated intestinal fluid | In Vitro | None | None | N.A. | ||
| 32888078 | 2020 | Mouse Myr-PTEN-PDZ | 8 | N-myristoyl | Free | Linear | L | Lipidation | Synthetic | Treatment of Alzheimer's diseases | Samples (80 μL) were taken at 0, 3, 6,9, 15, 30, 45, 60, 90, 120, 180, 240, 360 and 1440 min | Peptide stock solutions (120 μL) were added to pre-warmed diluted plasma (50% v/v, 1080 μL) | 4.52 | Hours | 16272 | Simulated intestinal fluid protease | HPLC | Simulated intestinal fluid | In Vitro | None | None | N.A. | ||
| 32888078 | 2020 | Mouse Myr-PTEN-PDZ | 8 | N-myristoyl | Free | Linear | L | Lipidation | Synthetic | Treatment of Alzheimer's diseases | Samples (80 μL) were taken at 0, 3, 6,9, 15, 30, 45, 60, 90, 120, 180, 240, 360 and 1440 min | Peptide stock solutions (120 μL) were added to pre-warmed diluted plasma (50% v/v, 1080 μL) | 1.36 | Hours | 4896 | 50% W/V liver homogenate protease | HPLC | 50% w/v liver homogenate | In Vitro | None | None | N.A. | ||
| 32858124 | 2020 | Cmpd# 6 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C6 | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.1 mg/kg | 2.31 | Hours | 8316 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE = 2.31 ± 0.57 | ||
| 32858124 | 2020 | Cmpd# 10 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C13 | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.1 mg/kg | 3.4 | Hours | 12240 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE = 6.22 ± 1.6 | ||
| 32858124 | 2020 | Cmpd# 12 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C15 | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.1 mg/kg | 1.84 | Hours | 6624 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE = 4.39 ± 0.73 | ||
| 32858124 | 2020 | Cmpd# 14 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C17 | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.1 mg/kg | 2.18 | Hours | 7848 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE =7.42 ± 0.9 | ||
| 32858124 | 2020 | Cmpd# 17 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C6 diacid | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.1 mg/kg | 2.32 | Hours | 8352 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE = 4.10 ± 0.62 | ||
| 32858124 | 2020 | Cmpd# 6 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C6 | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.5 mg/kg | 2.6 | Hours | 9360 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE = 2.31 ± 0.57 | ||
| 32858124 | 2020 | Cmpd# 17 | 16 | Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C6 diacid | Free | Linear | Mix | hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid | Derived from pyr-apelin-13 | Treatment of Chronic Hepatic Failure | N.A. | 0.5 mg/kg | 4.1 | Hours | 14760 | Male SD rats plasma protease | Scintillation proximity assay | Male SD rats plasma | In Vivo | None | None | Rat GTPγS (nM) EC50 ± SE = 4.10 ± 0.62 | ||
| 32847850 | 2020 | PPP2R5A | 407 | Free | Free | Linear | L | Blue fluorescent protein (BFP) labeling | encoded by the PPP2R5A gene in humans | Antiviral | 48 hours | 250 ng | ~2 | Hours | 7200 | 293T Cell Line Lysate Protease | flow cytometry | 293T cell line lysate with Vif | In Vivo | PDB id = 2IAE | None | N.A. | ||
| 32844654 | 2020 | Peptide 11 | 34 | Free | Amidation | Linear | L | None | PYY analog | Antiobesity | Blood samples were collected at 0.25, 0.5, 0.75, 1, 1.17, 1.33, 1.5, 2, 4, 6, 8, 24, 30, and 48 h after the start of infusion | 0.033 mg/kg | 1.2 | Hours | 4320 | Mouse plasma protease | UPLC-MS/MS | Mouse plasma | In Vivo | None | None | EC50 (nM) = 0.29 ± 0.03 for hNPY2R (cAMP) | ||
| 32844654 | 2020 | Peptide 18 | 34 | Free | Amidation | Cyclic (Cys-Cys Disulfide Bond) | L | Cysteine substiution at 23, 30 | PYY analog | Antiobesity | Blood samples were collected at 0.25, 0.5, 0.75, 1, 1.17, 1.33, 1.5, 2, 4, 6, 8, 24, 30, and 48 h after the start of infusion | 0.033 mg/kg | 4.5 | Hours | 16200 | Mouse plasma protease | UPLC-MS/MS | Mouse plasma | In Vivo | None | None | EC50 (nM) = 0.91 ± 0.08 for hNPY2R (cAMP) | ||
| 32844654 | 2020 | Peptide 11 | 34 | Free | Amidation | Linear | L | None | PYY analog | Antiobesity | Blood samples were collected between 0.25 and 48 h | 0.1 mg/kg | 1.21 | Hours | 4356 | Rats plasma protease | UPLC-MS/MS | Rats plasma | In Vivo | None | None | EC50 (nM) = 0.29 ± 0.03 for hNPY2R (cAMP) | ||
| 32812282 | 2020 | ACTH | 39 | Free | Free | Linear | L | None | Deriving from the pro-opimelanocortin (POMC) | Stimulates The Adrenal Cortex To Produce And Secrete Cortisol | 4 ◦C for 15 min | 40 μM | 250 | Minutes | 15000 | Human plasma protease | RP-HPLC | Human plasma | In Vitro | None | None | N.A. | ||
| 32759365 | 2020 | hAβ40 | 40 | Free | Free | Linear | L | None | Synthesized in neurons and degraded in the brain and liver | Treatment of Alzheimer's diseases | Serial blood sampling (0.15 mL) was performed after IV injections via the carotid artery catheter at times 0, 0.5, 1, 2, 5, 10, 15, 30, 45, 60, 90, 120, 150, and 180 min post-dose | 64.5 ± 13.2 µg/kg | 75.5 ± 17.9 (Terminal Half Life) | Minutes | 4530 | Untreated rats CSF protease | ELISA | untreated rats CSF | In Vivo | pdb id: 8KEW | None | N.A. | ||
| 32736262 | 2020 | EX-AFF | 84 | Free | AFF | Linear | L | None | Synthetic | Antiobesity | Blood was withdrawn at 0, 5 min, 30 min, 1 h, 2 h, 4 h, 6 h, and 8 h post-administratio | 50 nmol/kg | 1.5 | Hours | 5400 | ICR mice plasma protease | ELISA | ICR mice plasma | In Vivo | None | None | Kd(M) = 6.97 * 10-8(binding affinities of EX-ABD-AFF to glucagon-like peptide-1 receptor (GLP-1)) | ||
| 32603666 | 2020 | V-Gem | 1 | Free | Gemicitabine | Linear | L | None | Derived from Gemcitabine | Anticancer | 2, 5, 15, 30, 45, 60, 90, 120, 180, 240, 300, and 360 min | 76 nmol/g | 128 | Minutes | 7680 | Mice blood plasma protease | LC-MS/MS | Mice blood plasma (analyte = dFdU) | In Vivo | None | None | N.A. | ||
| 32603666 | 2020 | V-Gem | 1 | Free | Gemicitabine | Linear | L | None | Derived from Gemcitabine | Anticancer | 2, 5, 15, 30, 45, 60, 90, 120, 180, 240, 300, and 360 min | 228 nmol/g | 216 | Minutes | 12960 | Mice blood plasma protease | LC-MS/MS | Mice blood plasma (analyte = dFdU) | In Vivo | None | None | N.A. | ||
| 32582624 | 2020 | Entry 4 | 5 | Kψ[CH2NH]K substiuition | TMSAla conjugation | Linear | L | None | NT(8-13) analogs | Improve Nts1-Induced Protective Hypothermia | NT(8-13) and compounds without reduced amine bounds were incubated during short incubation times (0, 1, 2, 5, 10, and 30 min), whereas all analogs with reduced amine bounds, except compound 2, were tested during longer incubation times (0, 1, 2, 4, 8, 16, and 24 h) at 37°C | 0.156 mM | 2.0 ± 0.2 | Hours | 7200 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Binding, Ki (nM) = 2.5 ± 0.2 for hNTS1 | ||
| 32582624 | 2020 | Entry 10 | 6 | Kψ[CH2NH]K substiuition | Free | Linear | L | Substiution of Y amino acid with K | NT(8-13) analogs | Improve Nts1-Induced Protective Hypothermia | NT(8-13) and compounds without reduced amine bounds were incubated during short incubation times (0, 1, 2, 5, 10, and 30 min), whereas all analogs with reduced amine bounds, except compound 2, were tested during longer incubation times (0, 1, 2, 4, 8, 16, and 24 h) at 37°C | 0.156 mM | 5.0 ± 0.2 | Hours | 18000 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Binding, Ki (nM) = 6 600 ± 2 0003 for hNTS1 | ||
| 32506501 | 2020 | ACTH | 39 | Free | Free | Linear | L | None | Derived from POMC | Stimulates the adrenal glands to release cortisol | 37 °C | 2 µM | 3.79 | Hours | 13644 | Human plasma protease | Glo-sensor transfected cell-based luminescence assay | Human plasma | In Vitro | None | None | EC50 (M) = 1.54E-09 for MC1R-ACTH | ||
| 32506501 | 2020 | gamma3-MSH | 26 | Free | Free | Linear | L | None | Derived from POMC | Antiinflammatory and Cardiovascular function | 37 °C | 2 µM | 2.62 | Hours | 9432 | Human plasma protease | Glo-sensor transfected cell-based luminescence assay | Human plasma | In Vitro | None | None | EC50 (M) = 9.37E-10 for MC1R-g3-MSH | ||
| 32506501 | 2020 | gamma2-MSH | 12 | Free | Amidation | Linear | L | None | Derived from POMC | Antiobesity | 37 °C | 2 µM | 1.44 | Hours | 5184 | Human CSF protease | Glo-sensor transfected cell-based luminescence assay | Human CSF | In Vitro | None | None | EC50 (M) = 7.749E-10 for MC1R-g2-MSH | ||
| 32380198 | 2020 | Apelin-12 | 12 | Free | Free | Linear | L | None | Smallest fragment of a 77 amino acid prepropeptide | Cardioprotective Properties | N.A. | 2-3 mg/ml | 165 (Terminus Half Life) | Minutes | 9900 | Human blood plasma protease | 1H-NMR | Human blood plasma | In Vitro | None | None | peptide M showed a significantly more pronounced effect in improving LV systolic function in Dox-induced cardiomyopathy compared to apelin-12 at a dose of 50 μg/kg | ||
| 32348108 | 2020 | SAH-GLP-1-A8J(16,23) | 28 | Aminoisobutyric acid | Free | Linear | L | Modifications include (R-octenyl alanine) and (Bis-pentenyl glycine) | Single-stapled analogs of GLP-1 | Antidiabetes | 20 μl aliquots were removed at 0, 5, 15, 30, 60, 120 and 200 min | 1 mM | 120 | Minutes | 7200 | Proteinase K | LC-MS/MS | DMSO + buffer consisting of 50 mM Tris HCl, pH 7.4 | In Vitro | PDB:3IOL | None | EC50 = 160 pM for SAH-GLP-1(16, 23, 30) | ||
| 32348108 | 2020 | stitched GLP-1 | 30 | Free | Free | Cyclic (I, I+7 Stitched GLP) | L | None | Stitched GLP-1 | Antidiabetes | 20 μl aliquots were removed at 0, 5, 15, 30, 60, 120 and 200 min | 1 mM | 220 | Minutes | 13200 | Proteinase K | LC-MS/MS | DMSO + buffer consisting of 50 mM Tris HCl, pH 7.4 | In Vitro | None | None | EC50 = 160 pM for SAH-GLP-1(16, 23, 30) | ||
| 32348108 | 2020 | Semaglutide | 31 | Free | Free | Linear | L | Aib modification at position 2, Lys26 side chain conjugated with (ADO-linker-Glu-C18) | GLP-1 analogs | Antidiabetes | 20 μl aliquots were removed at 0, 5, 15, 30, 60, 120 and 200 min | 10 μM | 170 | Minutes | 10200 | Mouse plasma protease | LC-MS/MS | Mouse plasma | In Vitro | None | None | EC50 = 160 pM for SAH-GLP-1(16, 23, 30) | ||
| 32169063 | 2020 | IFN-1CTPON | 216 | Free | Carboxyl-terminal peptide (CTP) of the human chorionic gonadotropin β subunit and N-linked glycosylation sequences were linked to rhIFN-α2b at C terminus | Linear | L | None | Derived from rhIFN-α2b | Antiviral, Antitumor | Intraocular venous blood was collected at 0.5, 1, 2, 4, 8, and 24 h postinjection | 50 μg/kg | 2.62 ± 0.34 | Hours | 9432 | Mice blood protease | ELISA | Mice blood sample | In Vivo | PDB id: 1ITF | None | Antiviral activities of IFN-1CTPON = 8.22 × 106 IU/mg | ||
| 32169063 | 2020 | IFN-2CTPON | 244 | Carboxyl-terminal peptide (CTP) of the human chorionic gonadotropin β su bunit and N-linked glycosylation sequences were linked to rhIFN-α2b at N terminus | Carboxyl-terminal peptide (CTP) of the human chorionic gonadotropin β su bunit and N-linked glycosylation sequences were linked to rhIFN-α2b at C terminus | Linear | L | None | Synthetic | Antiviral, Antitumor | Intraocular venous blood was collected at 0.5, 1, 2, 4, 8, and 24 h postinjection | 50 μg/kg | 3.45 ± 0.87 | Hours | 12420 | Mice blood protease | ELISA | Mice blood sample | In Vivo | PDB id: 1ITF | None | Antiviral activities of IFN-2CTPON = 3.12 × 106 IU/mg | ||
| 32169063 | 2020 | rhIFN-α2b | 165 | Free | Free | Linear | L | None | Synthetic | Antiviral, Antitumor | Intraocular venous blood was collected at 0.5, 1, 2, 4, 8, and 24 h postinjection | 50 μg/kg | 1.34 ± 0.48 | Hours | 4824 | Mice blood protease | ELISA | Mice blood sample | In Vivo | PDB id: 1RH2 | None | Antiviral activities of rhIFN-α2b = 5.29 × 107 IU/mg | ||
| 32141733 | 2020 | TB1 | 6 | Fluorescein | Amidation | Linear | L | None | Fluorescein analog of BVD15 | Stabilization of cancer imaging peptides | 37 °C | 50 μM | 1.5 | Hours | 5400 | Mouse serum protease | HPLC | Mouse serum | In Vitro | https://sci-hub.se/10.1021/acs.molpharmaceut.6b00464 | None | KI = 53 ± 10 nM, The IC50 values determined for TB1 and TB1-RS6 (719 ± 143 nM and 1363 ± 323 nM, respectively | ||
| 32075870 | 2020 | Apraglutide | 33 | Free | Amidation | Linear | L | Gly2, Nle10, D-Phe11, Leu16 modification | Derived from hGLP-2 | Treatment of Short Bowel Syndrome | Blood samples were collected at multiple time points up to 6 h post injection | 0.2 mg/kg | 159 ± 27(Elimination Half Life) | Minutes | 9540 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vivo | None | None | EC50(nM) = 0.24 for hGLP-2 receptor | ||
| 32075870 | 2020 | Teduglutide | 33 | Free | Free | Linear | L | G amino acid substituition at position 2 | Derived from hGLP-2 | Treatment of Short Bowel Syndrome | Blood samples were collected at multiple time points up to 6 h post injection | 0.100 mg/kg | 88 ± 11 (Elimination Half Life) | Minutes | 5280 | Göttingen minipigs plasma protease | LC-MS/MS | Göttingen minipigs plasma | In Vivo | None | None | EC50(nM) = 0.09 for hGLP-2 receptor | ||
| 32075870 | 2020 | Teduglutide | 33 | Free | Free | Linear | L | G amino acid substituition at position 2 | Derived from hGLP-2 | Treatment of Short Bowel Syndrome | Blood samples were collected at multiple time points up to 169 h post injection | 0.15 mg/kg | 2.7 ± 0.8 (Terminal Half Life) | Hours | 9720 | Göttingen minipigs plasma protease | LC-MS/MS | Göttingen minipigs plasma | In Vivo | None | None | EC50(nM) = 0.09 for hGLP-2 receptor | ||
| 32034289 | 2020 | α-GD2 scFv TM | None | Radiolabelled with 64Cu | E5B9 | Linear | L | VH and VL joined by linker (GGGGS)3 | Synthetic | Antitumor | N.A. | N.A. | 1.6 | Hours | 5760 | Mice blood protease | PET scanning | Mice blood sample | In Vivo | E5B9 sequence available on this link: https://pmc.ncbi.nlm.nih.gov/articles/PMC6805801/ | None | EC50 = 0.7 nM (target cell lysis) | ||
| 32023048 | 2020 | ICP NPs | 8 | Free | One 4-carboxy-3-fluorophenylboronic acid (PBA), Three cholic acids (CA) | Linear | L | None | Synthetic | Transcellular Tumor Penetration And Photo−Chemo Combination Therapy | Blood samples (∼0.2 mL each time point) were collected from the jugular vein cannula to centrifuge tubes containing 20 μL of 10 IU heparin at predetermined time points (5, 10, 15, 30, 60, 120, 180, 240, 360, 720, 1440 min) | 3 mg/kg | 3.34 ± 0.86 | Hours | 12024 | Female wistar rats plasma protease | HPLC | Female wistar rats plasma | In Vivo | None | None | Additional phototherapy by treatment with laser further enhanced the antitumor activity of both ICP and hICP NPs, leading to a complete cure rate of 10% and 50%, respectively | ||
| 31996466 | 2020 | D6PV | 40 | Free | Free | Linear | L | Replaces 18A with a modified central region of apoC-II | Derived from apoC-II | TG-Lowering Effects | N.A. | 46.7 mg/kg | 3 (Initial Elimination Half Life) | Hours | 10800 | Mice plasma protease | LC-MS/MS | Mice plasma | In Vivo | None | None | Equilibrium dissociation constant (Kd) of D6PV binding to HDL was determined to be 18.5 μM | ||
| 31926774 | 2020 | PEG5K-LEU | 10 | Free | Free | Linear | L | PEGylation at His2 | Derived from leuprolide | Anticancer (Treatment of Advanced Prostate Cancer) | Blood samples were collected from rats orbit at predetermined time interval | 1.0 mg/kg | 1.28 ± 0.64 | Hours | 4608 | SD rats serum protease | UPLC–MS/MS | SD rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC6017563/ | None | The weight of testis of the rats received unmodified leuprolide, PEG2K-LEU and PEG5K-LEU decreases to be ~57%, ~58%, and ~52% of the untreated group | ||
| 31926774 | 2020 | PEG5K-LEU | 10 | Free | Free | Linear | L | PEGylation at His2 | Derived from leuprolide | Anticancer (Treatment of Advanced Prostate Cancer) | Blood samples were collected from rats orbit at predetermined time interval | 1.0 mg/kg | 1.51 ± 0.127 | Hours | 5436 | SD rats serum protease | UPLC–MS/MS | SD rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC6017563/ | None | The weight of testis of the rats received unmodified leuprolide, PEG2K-LEU and PEG5K-LEU decreases to be ~57%, ~58%, and ~52% of the untreated group | ||
| 31841696 | 2020 | P9 | 11 | Free | Amidation | Linear | L | None | Synthetic | Anticancer | 37 °C for 5, 10, 20, 25, 30, 45 min | N.A. | 19 | Minutes | 6692.4 | Human plasma protease | HPLC | Human plasma | In Vitro | https://sci-hub.se/10.1007/s13277-015-3435-x | None | IC50 of P48 for Hela229 = 0.6 nM | ||
| 31841696 | 2020 | P48 | 10 | Leucine reduction | Amidation | Linear | L | None | Generated with P9 degradation | Anticancer | 1, 2, 3, 4, 5, 10, 12 h. | N.A. | 4 | Hours | 14400 | Human plasma protease | HPLC | Human plasma | In Vitro | https://sci-hub.se/10.1007/s13277-015-3435-x | None | IC50 of P48 for Hela229 = 0.6 nM | ||
| 31776208 | 2020 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected at pre-dose and 0.25, 0.5, 1, 2, 4, 8, and 24 hour after sHDL administration | 50 mg/kg | 2.1 | Hours | 7560 | Rats serum protease | LC-MS | SD rats serum | In Vivo | None | None | The binding of a peptide to phospholipid was also confirmed by increased helicity of 22A, 21A, and 22A-P in sHDL particles (94%, 91%, and 82%) relative to the free peptide (77%, 79%, and 77%) as measured by CD | ||
| 31776208 | 2020 | 22A-P | 23 | Free | Proline addition at C terminal | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected at pre-dose and 0.25, 0.5, 1, 2, 4, 8, and 24 hour after sHDL administration | 50 mg/kg | 4.2 | Hours | 15120 | Rats serum protease | LC-MS | SD rats serum | In Vivo | None | None | The binding of a peptide to phospholipid was also confirmed by increased helicity of 22A, 21A, and 22A-P in sHDL particles (94%, 91%, and 82%) relative to the free peptide (77%, 79%, and 77%) as measured by CD | ||
| 31776208 | 2020 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected at pre-dose and 0.25, 0.5, 1, 2, 4, 8, and 24 hours after sHDL administration | 50 mg/kg | 3.3 | Hours | 11880 | Rats serum protease | LC-MS | SD rats serum | In Vivo | None | None | The binding of a peptide to phospholipid was also confirmed by increased helicity of 22A, 21A, and 22A-P in sHDL particles (94%, 91%, and 82%) relative to the free peptide (77%, 79%, and 77%) as measured by CD | ||
| 31776208 | 2020 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected at pre-dose and 0.25, 0.5, 1, 2, 4, 8, and 24 hours after sHDL administration | 50 mg/kg | 3 | Hours | 10800 | Rats serum protease | LC-MS | SD rats serum | In Vivo | None | None | The binding of a peptide to phospholipid was also confirmed by increased helicity of 22A, 21A, and 22A-P in sHDL particles (94%, 91%, and 82%) relative to the free peptide (77%, 79%, and 77%) as measured by CD | ||
| 31776208 | 2020 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected at pre-dose and 0.25, 0.5, 1, 2, 4, 8, and 24 hours after sHDL administration | 50 mg/kg | 3.3 | Hours | 11880 | Rats serum protease | LC-MS | SD rats serum | In Vivo | None | None | The binding of a peptide to phospholipid was also confirmed by increased helicity of 22A, 21A, and 22A-P in sHDL particles (94%, 91%, and 82%) relative to the free peptide (77%, 79%, and 77%) as measured by CD | ||
| 31776208 | 2020 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood samples were collected at pre-dose and 0.25, 0.5, 1, 2, 4, 8, and 24 hours after sHDL administration | 50 mg/kg | 3.3 | Hours | 11880 | Rats serum protease | LC-MS | SD rats serum | In Vivo | None | None | The binding of a peptide to phospholipid was also confirmed by increased helicity of 22A, 21A, and 22A-P in sHDL particles (94%, 91%, and 82%) relative to the free peptide (77%, 79%, and 77%) as measured by CD | ||
| US 201214350192 A | 2020 | Ac-(06-34-18) (wildtype) | 12 | Acetylation | Free | Linear | L | None | Synthetic | Targets plasma kallikrein | N.A. | 5 uM | 2.3 | Hours | 8280 | Rats plasma protease | Waters Xevo TQ-MS | Rats plasma | In Vitro | None | US 201214350192 A | IC50(nM)(rat kallikrein) = 1.7 | ||
| US 201214350192 A | 2020 | Ac-(06-34-18) ( 4GuanPhe5) | 12 | Acetylation | Free | Linear | L | 4GuanPhe6 replaces Arg (R) | Synthetic | Targets plasma kallikrein | N.A. | 5 uM | 2.8 | Hours | 10080 | Rats plasma protease | Waters Xevo TQ-MS | Rats plasma | In Vitro | None | US 201214350192 A | IC50(nM)(rat kallikrein) = 21 | ||
| US 201214350192 A | 2020 | Ac-(06-34-18) Phe2 Tyr4 4GuanPhe5 | 12 | Acetylation | Free | Linear | L | 4GuanPhe replaces Arg (R) at position 6,Tryptophan (W) at position 3 is replaced with Phe, alanine (A) at position 5 is replaced with Tyr | Synthetic | Targets plasma kallikrein | N.A. | 5 uM | 5 | Hours | 18000 | Rats plasma protease | Waters Xevo TQ-MS | Rats plasma | In Vitro | None | US 201214350192 A | IC50(nM)(rat kallikrein) = 2.5 | ||
| 31843919 | 2019 | ZY4 | 17 | Free | Amidation | Cyclic (C2-C16 Disulfide Bond) | L | None | Cathelicidin-BF15 analogs | Antimicrobial | Blood samples were drawn retroorbitally under short-term anesthesia at different time points (1, 5, 10, 30, 60 min, and 2, 5, 10, 18, 24 h) | 8 mg/kg | 1.859 | Hours | 6692.4 | Mice plasma protease | LC-MS/MS | Mice plasma | In Vivo | None | None | MIC (µM) = 1.9 for ZY4 in P. aeruginosa CICC21625 , MIC (µM) = 2 for ZY4 in B. subtilis , MIC (µM) = 2 for ZY4 in S. aureus , MIC (µM) = 2 for ZY4 in C. albicans | ||
| 31805154 | 2019 | CP24 | 24 | Free | Free | Linear | L | None | Synthetic | Antiviral (HIV-1 Fusion Inhibitory Peptide) | Serial blood samples were collected from monkeys that received CP24 or IBP-CP24 before injection and at 2, 4, 6, 24, 72 and 144 h post-injection | 10 mg/kg | 1.69 | Hours | 6084 | Rhesus monkeys plasma protease | Sandwich ELISA | Rhesus monkeys plasma | In Vivo | None | None | IC50(nM) = 0.8±0.2 for CP24 in virus subtype A (92UG029) | ||
| 31654685 | 2019 | Off-target repebody-fused GLP-1 | 50 | Repebody | GLP-1(7-36) (A8G) fused to the off-target repebody through linker (A(EAAAAK)3A) at C terminus | Linear | L | None | Synthetic | Antidiabetes | Mice were euthanized at predetermined time points (n = 5 mice each at 0.05, 0.5, 1, 3, 6, 12 and 24 h post-injection) to collect whole blood from the aorta abdominalis | 25 nmol/kg | 1.3 (Initial Half Life) | Hours | 4680 | Mice plasma protease | Sandwich ELISA | Mice plasma | In Vivo | PDB id: 5VAI | None | C57BLKS/J lar- Leprdb/Leprdb mice (n = 5 per group, 6 weeks) were intravenously injected with the repebody-fused GLP-1 in complex with HSA, an off-target repebody-fused GLP-1, native GLP-1, and PBS. The blood glucose levels were analyzed at each time point for 24 h. The HSA-specific repebody-fused GLP-1 showed a significant decrease (**p < 0.005) in blood glucose level compared to other cases | ||
| 31654685 | 2019 | Repebody-fused GLP-1 in complex with HSA | 50 | Repebody | GLP-1(7-36) (A8G) fused to the repebody in complex with HSA through linker (A(EAAAAK)3A) at C terminus | Linear | L | None | Synthetic | Antidiabetes | Mice were euthanized at predetermined time points (n = 5 mice each at 0.05, 0.5, 1, 3, 6, 12 and 24 h post-injection) to collect whole blood from the aorta abdominalis | 25 nmol/kg | 4.2 (Initial Half Life) | Hours | 15120 | Mice plasma protease | Sandwich ELISA | Mice plasma | In Vivo | PDB id: 5VAI | None | C57BLKS/J lar- Leprdb/Leprdb mice (n = 5 per group, 6 weeks) were intravenously injected with the repebody-fused GLP-1 in complex with HSA, an off-target repebody-fused GLP-1, native GLP-1, and PBS. The blood glucose levels were analyzed at each time point for 24 h. The HSA-specific repebody-fused GLP-1 showed a significant decrease (**p < 0.005) in blood glucose level compared to other cases | ||
| 31594790 | 2019 | RLYE | 4 | Free | Free | Linear | L | None | Synthetic | Antitumor | 4 hours at 37°C | 2 µg/µl | 73 | Minutes | 4380 | Human serum protease | HPLC | Human serum | In Vitro | None | None | IC50 = 89.1 pM (inhibitory activity against VEGF-A-induced tube formation of HUVEC) | ||
| 31594790 | 2019 | RLYE-NH2 | 4 | Free | Amidation | Linear | L | None | Synthetic | Antitumor | 4 hours at 37°C | 2 µg/µl | 1.3 | Hours | 4680 | Human serum protease | HPLC | Human serum | In Vitro | None | None | IC50 = 326.6 pM (inhibitory activity against VEGF-A-induced tube formation of HUVEC) | ||
| 31580912 | 2019 | Exenatide | 39 | Free | Amidation | Linear | L | Fluorescence dye | Synthetic | Hypoglycemic Activity | Fluorescence intensity was monitored in nude mice by non-invasive live imaging at 0, 1, 2, 4, 8, 24, and 48 h | 1 mg/ml | 1.6 | Hours | 5760 | Nude mice serum protease | Fluorescence assay | Nude mice serum | In Vivo | PDB id: 7MLL | None | EC50(M) = 6.1 × 10−10 ± 9.3 × 10−11 | ||
| 31580912 | 2019 | Exenatide K12C | 39 | Free | Amidation | Linear | L | K12C modification, fluorescence dye | Synthetic | Hypoglycemic Activity | Fluorescence intensity was monitored in nude mice by non-invasive live imaging at 0, 1, 2, 4, 8, 24, and 48 h | 1 mg/ml | 2.5 | Hours | 9000 | Nude mice serum protease | Fluorescence assay | Nude mice serum | In Vivo | None | None | EC50(M) = 4.0 × 10−11 ± 1.4 × 10−12 for K12C-PEG 5KDa | ||
| 31580912 | 2019 | K12C-PEG 5kD | 39 | Free | Amidation | Linear | L | K12C modification, fluorescence dye, PEG(5KDa) conjugation at Lys27 | Synthetic | Hypoglycemic Activity | Fluorescence intensity was monitored in nude mice by non-invasive live imaging at 0, 1, 2, 4, 8, 24, and 48 h | 1 mg/ml | 1.7 | Hours | 6120 | Nude mice serum protease | Fluorescence assay | Nude mice serum | In Vivo | None | None | EC50(M) = 4.0 × 10−11 ± 1.4 × 10−12 | ||
| 31580912 | 2019 | K12C-PEG 10 kD-K12C | 39 | Free | Free | Linear | L | Lys27 conjugaged with (PEG(10KDa)-HGEGTFTSDLSCQMEEEAVRLFIEWLKNGGPSSGAPPPS) | Synthetic | Hypoglycemic Activity | Fluorescence intensity was monitored in nude mice by non-invasive live imaging at 0, 1, 2, 4, 8, 24, and 48 h | 1 mg/ml | 2.1 | Hours | 7560 | Nude mice serum protease | Fluorescence assay | Nude mice serum | In Vivo | None | None | EC50(M) = 4.4 × 10−11 ± 4.9 × 10−12 | ||
| 31389463 | 2019 | OXM | 37 | Free | Free | Linear | L | None | Secreted postprandially by intestine L-cells | Antidiabetes, Antiobesity | blood was sampled pre-dose and at 0.5, 1, 2, 4, 8, 24, 48, 72, and 96 h post-dose | 30 nmoL/kg | 2.1 ± 0.6 | Hours | 7560 | SD rats plasma protease | LC-MS, ELISA | SD rats plasma | In Vivo | pdb id: 7LLY_5 | None | EC50(nM) = 0.691 for Human GLP-1R | ||
| 31368418 | 2019 | EX | 39 | Free | Free | Linear | L | O=Ornithine | GLP-1 analogs | Antidiabetes | Blood samples were collected before and after administration at 1, 3, and 6 h and 1–35 d | 2 mg/kg | 2.59 ± 0.05 | Hours | 9324 | SD rats plasma protease | ELISA | SD rats plasma | In Vivo | None | None | The blood glucose levels of saline-treated controls remained at 20 mM, while EX or LA-EX rapidly decreased the levels of blood glucose to approximately 10 mM after administration, which were maintained for approximately 6 h | ||
| 31480738 | 2019 | PEG2kC34 | 35 | 2 kDa PEG conjugated to the N-terminus of cC34 through Mal linker | Free | Linear | L | None | Synthetic | Antiviral (HIV-1 fusion inhibitory peptides) | Blood samples (300 μL) were harvested from the tail vein before injection and at different time intervals after injection (0.5, 1.0, 2.0, 4.0, 6.0, 8.0, 10.0 and 24.0 h | 1.7 μmol/kg | 2.57 ± 0.71 | Hours | 9252 | Rats plasma protease | N.A. | Rats plasma | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC7343207/ | None | EC50 =4.14 ± 1.89 for NL4-3 strain | ||
| 31453257 | 2019 | Pept. A | None | Free | Free | Cyclic | L | N.A. | N.A. | Therapeutic agent against a CNS-related disorder | Blood (100 µl) and CSF (100 µl) aliquots for drug concentration assessment were collected pre-dose, on study day 1 at 0.5, 1.5, 3, 6, and 24 h post first dose, and on study day 2 at 1.5 h post the second dose (corresponding to 25.5 h from study start) | 4.2 mg/kg | 3.5 ± 0.7 (Terminal Half Life) | Hours | 12600 | Göttingen minipigs plasma protease | LC-MS/MS | Göttingen minipigs plasma | In Vivo | None | None | N.A. | ||
| 31443263 | 2019 | LL-37 | 37 | Free | Free | Linear | L | None | Synthetic | Antiinflammatory (Treatment of Several Intestinal Inflammation Conditions) | 37 °C | N.A. | 242.47 ± 45.09 | Minutes | 14548.2 | Rats plasma proteaes | HPLC | 10 μg/mL rats plasma | In Vitro | None | None | Among the peptides, LTP exhibited a lower cytotoxicity than LL-37 and TP5. In addition, LTP exhibited no significant cytotoxicity towards RAW264.7 cells, even at the highest concentration of 60 µg/mL | ||
| 31443263 | 2019 | LTP | 29 | Free | TP5 conjugated with LTP(13-36) at C terminus | Linear | L | None | Synthetic | Antiinflammatory (Treatment of Several Intestinal Inflammation Conditions) | 37 °C | N.A. | 240.03 ± 55.14 | Minutes | 14401.8 | Rats plasma proteaes | HPLC | 10 μg/mL rats plasma | In Vitro | None | None | Among the peptides, LTP exhibited a lower cytotoxicity than LL-37 and TP5. In addition, LTP exhibited no significant cytotoxicity towards RAW264.7 cells, even at the highest concentration of 60 µg/mL | ||
| 31278957 | 2019 | Exenatide | 39 | Free | Amidation | Linear | L | Labeled with Flamma® 675 vinylsulfone | Exendin-4 analogs | Antidiabetes | The fluorescence images of the mice were measured at 0, 1, 2, 4, 8, 12, 24, 48, 72, 96, and 147 h after injection | 20 μg | 2.2 | Hours | 7920 | Mouse body protease | In vivo imaging system | Mouse body | In Vivo | PDB id: 7MLL | None | N.A. | ||
| 31194563 | 2019 | Fasudil in CAR-liposome | 9 | Conjugation of amino groups of the lipids of liposomes with CAR peptide at N terminal Cys | Amidation | Linear | L | None | Synthetic | Treatment of Pulmonary Arterial Hypertension | N.A. | 3 mg/kg | 1.1 ± 0.3 | Hours | 3960 | PAH rats plasma protease | LC–MS/MS | PAH rats plasma | In Vivo | None | None | N.A. | ||
| 31100806 | 2019 | Lysostaphin | 255 | Free | Free | Linear | L | None | Produced by Staphylococcus simulans | Antibacterial | The blood was sampled from the tail vein at 25 min, 40 min, 1 h, 2 h, and 4 h time points in the group that received lysostaphin | 1 mg/ml | 1.5 ± 0.7 | Hours | 5400 | Rats plasma protease | Sandwich ELISA | Rats plasma | In Vivo | PDB id: 4LXC | None | Minimum inhibitory concentration (MIC) of Lst-HDD towards S. aureus ATCC 29,213 was 3.2 µg/mL and concentration is 0.1 µg/mL | ||
| 31100806 | 2019 | Lst-HDD | 320 | Free | Free | Linear | L | None | Derived from Lysostaphin | Antibacterial | 25 min, 40 min, 1 h, 2 h, 4 h, and 6 h time points in the group that received Lst-HDD | 1 mg/ml | 3.1 ± 0.6 | Hours | 11160 | Rats plasma protease | Sandwich ELISA | Rats plasma | In Vivo | None | None | MIC of Lst-HDD is 32 times higher than the MIC of lysostaphin in S. aureus ATCC 29,213 in —0.1 µg/mL | ||
| 31040673 | 2019 | ES2-AF | 21 | Free | VEGFR1-selective hexapeptide (GNQWFI, AF) ,amidation | Linear | L | FITC labeled | Synthetic | Antiangiogenic | Blood samples were collected through the fundus venous plexus, 0.5–24 hours after administration | 20 mg/kg | 2.34 ± 0.43 | Hours | 8424 | Mice plasma protease | Fluorescence spectrometry | Mice plasma | In Vivo | None | None | The inhibitory rates of ES2-AF and CS-ES2-AF were similar (5 μg/mL–100 μg/mL), which indicated that the activity of ES2-AF was similar to CS-ES2-AF at relatively low concentrations | ||
| 30986342 | 2019 | P-T4-Cy5.5 | 11 | PEGylation | Conjugated with Cy5.5 | Linear | L | Diethylaminopropyl isothiocyanate (DEAP) conjugation at Lys1 side chain | Synthetic | Antitumor | N.A. | N.A. | 2 | Hours | 7200 | Mice plasma protease | Fluorescence assay | Mice plasma | In Vivo | None | None | Free T4 or P-T4 slowed tumor regrowth after chemotherapy, whereas the P-T4 treatment group exhibited a better suppressive effect | ||
| 30973007 | 2019 | GBAP | 11 | Free | Free | Cyclic (Ser3-Met11 bond) | L | None | Produced by Enterococcus faecalis | Antibacterial | Time points were taken at 0 min, 30 min, 1 hr, 2 hr, 4 hr, 8 hr, and 24 hr | 0.28 mM | 4 | Hours | 14400 | N.A. | HPLC | pH 7.2 buffer | In Vitro | None | None | EC50 (nM) = 1.15 for GBAP | ||
| 35520704 | 2019 | Liraglutide | 32 | Free | Free | Linear | L | Lys-34 is replaced by Arg and Lys-26 is acylated with a C16 palmitic acid linkd with γGlu | GLP-1 analogs | Antidiabetes | At each predetermined times (1, 2, 3, 4, 6, 12, 24 and 36 h), there mice were sacrificed and ∼200 μL of blood samples were collected | 50 nmol/kg | 3.9 ± 0.3 | Hours | 14040 | Kunming mice plasma protease | LC-MS/MS | Kunming mice plasma | In Vivo | None | None | EC50 = 0.72 ± 0.27 nM | ||
| 35520704 | 2019 | Di-GLP-1 | 62 | Free | Bis-maleimide-NH2 | Linear | L | None | GLP-1 analogs | Antidiabetes | At each predetermined times (1, 2, 3, 4, 6, 12, 24 and 36 h), there mice were sacrificed and ∼200 μL of blood samples were collected | 50 nmol/kg | 1.8 ± 0.2 | Hours | 6480 | Kunming mice plasma protease | LC-MS/MS | Kunming mice plasma | In Vivo | PDB id: 5VAI | None | EC50 = 0.039 ± 0.007 nM | ||
| 30901967 | 2019 | YIK | 34 | Free | Free | Linear | L | T639I mutation | HP23-E6-IDL analogue | Antiviral (Anti-Hiv Activity) | Mouse serum samples were collected before (0 h) and after injection (0.5, 1, 2, 4, and 6 h for peptides YIK | 5 mg/kg | 1.3 | Hours | 4680 | Mice serum protease | N.A. | Mice serum | In Vivo | None | None | IC50(pM) = 784 ± 32 in HIV-1 NL4-3 D36G (WT)(Inhibitory activities of YIK against infection by HIV-1 mutants resistant to T20) | ||
| 30900390 | 2019 | Ac-SD(d)K(d)P | 4 | Acetylation | Free | Linear | Mix | Asp2 and Lys3 were replaced with their D-isomers | Synthetic | Antifibrotic effects on Hepatic Fibrosis | At 2, 4, 6, 8, 10, 18, 30, 120, 360, 480, and 540 min after the injection, 50 μL of blood was sampled from each animal through the caudal vein | 1 mg/kg | 176.5 ± 6.45 | Minutes | 10590 | Rats serum protease | RP-HPLC | Rats serum | In Vivo | None | None | Ac-SD(d)K(d)P and Ac-SDKP exhibited similar antifibrotic effects in vitro | ||
| 30900390 | 2019 | Ac-SD(d)K(d)P | 4 | Acetylation | Free | Linear | Mix | Asp2 and Lys3 were replaced with their D-isomers | synthetic | Antifibrotic Effects On Hepatic Fibrosis | 9 h at 37 C | 100 μM | 161.5 ± 5.79 | Minutes | 9690 | Human Serum Protease | HPLC | human serum | In Vitro | None | None | Ac-SD(d)K(d)P and Ac-SDKP exhibited similar antifibrotic effects in vitro | ||
| 30817059 | 2019 | Porcine C‐Peptide | 29 | Free | Free | Linear | L | None | Released from the pancreatic beta cells when proinsulin is processed into insulin and C-peptide | Used as marker of insulin production | Blood samples (200 μL each) were collected through the catheter at 5, 15, 30, 60, 90 and 120 minutes after intraperitoneal injection | 200 pmol/kg | 92 ± 21 (Terminal Elimination Half Life) | Minutes | 5520 | Rats plasma protease | ELISA | Rats plasma | In Vivo | https://www.jbc.org/article/S0021-9258(19)41064-8/pdf | None | N.A. | ||
| 30814652 | 2019 | Adnectin C-PAS#1(200) | 20 | Free | PAS#1(200) | Linear | L | None | Adnectin C analogs | Anticancer | Blood samples were taken after 5 min, 15 min, 30 min, 1 h, 2 h, 3 h, 4 h, 6 h, 8 h, 12 h, 24 h, 36 h, 48 h, 72 h, and 96 h | 5 mg/kg | 226.2 | Minutes | 13572 | Mice plasma protease | ELISA | Mice plasma | In Vivo | None | None | Kd(1/s) =2.476E − 5 | ||
| 30809901 | 2019 | FITC-AAR029b | 6 | FITC labelled | Free | Macrocyclic | L | X=Structure given in paper | Derived from a class of peptides known as cyclic peptide triazoles (cPTs) | Antiviral | N.A. | 0.01 mg/kg | 2.92 ± 0.93 (T1/2b-Elimination Half Life) | Hours | 10512 | Rats plasma protease | Fluorescence assay | Rats plasma | In Vivo | None | None | EC50(nM) = 210±16 for AAR029b in Bal.01 virus | ||
| 30690406 | 2019 | Apelin6 | 20 | R1 = PALM-Lys-Phe-Arg | Free | Linear | L | None | Apelin analogs | Blood Pressure lowering agents | 37 C for up to 72 h | N.A. | 1.5 | Hours | 5400 | RHNEP | LC-MS | Apelin6 | In Vitro | None | None | EC50(nM) = 2.6 ± 0.8 | ||
| 30690406 | 2019 | Apelin7 | 20 | R1 = PEG-Lys-Phe-Arg | Free | Linear | L | None | Apelin analogs | Blood Pressure lowering agents | 37 C for up to 72 h | N.A. | 1.4 | Hours | 5040 | RhKLKB1 | LC-MS | Apelin7 | In Vitro | None | None | EC50(nM) = 6.3 ± 1.0 | ||
| 30690406 | 2019 | Apelin8 | 20 | R1 = PALM-Lys-Phe-Arg | Free | Linear | L | R2= Me, Methylation at Gln8 | Apelin analogs | Blood Pressure lowering agents | 37 C for up to 72 h | N.A. | 2.1 | Hours | 7560 | RhKLKB1 | LC-MS | Apelin8 | In Vitro | None | None | EC50(nM) = 11.3 ± 2.1 | ||
| 30690406 | 2019 | Apelin9 | 20 | R1 = PEG-Lys-Phe-Arg | Free | Linear | L | R2= Me, Methylation at Gln8 | Apelin analogs | Blood Pressure lowering agents | 37 C for up to 72 h | N.A. | 2.9 | Hours | 10440 | RhKLKB1 | LC-MS | Apelin9 | In Vitro | None | None | EC50(nM) = 2.5 ± 1.5 | ||
| 30690406 | 2019 | Apelin3 | 20 | R1 = NH2-Lys-Phe-Arg | Free | Linear | L | R2=Me, Methylation at Glu8 | Apelin analogs | Blood Pressure lowering agents | 37 C for up to 72 h | N.A. | 1.2 | Hours | 4320 | hplasma protease | LC-MS | hplasma | In Vitro | None | None | EC50(nM) = 4.9 ± 1.0 | ||
| 30690406 | 2019 | Apelin6 | 20 | R1 = PALM-Lys-Phe-Arg | Free | Linear | L | None | Apelin analogs | Blood Pressure lowering agents | 37 C for up to 72 h | N.A. | 4.5 | Hours | 16200 | hplasma protease | LC-MS | hplasma | In Vitro | None | None | EC50(nM) = 2.6 ± 0.8 | ||
| 30624060 | 2019 | Compound 14 | 9 | yGlu-(OEG)2 linker between C14 fatty acid and peptide | Amidation | Linear | Mix | Phe(4sm) = 4-sulfomethylphenylalanine, Nle = Nor-leucine, DMeAsp = N-methylated D-Asp, MePhe = Methylated-phenylalanine | CCK-8 analogue | Role in the regulation of energy balance | The blood samples were collected at following time points relative to dosing: predose, 0.083, 0.25, 0.5, 0.75, 1, 1.5, 2, 3, 4, 6, 8, 10, 24, 48, 72, 96, 120, 168, 192, 216, 240, 264, and 288 h | 5 nmol/kg | 2 (Terminal Half Life) | Hours | 7200 | Female göttingen minipigs plasma protease | LC-MS | Female göttingen minipigs plasma | In Vivo | None | None | pEC50 = 9.74 (In Vitro CCK-1R Potency) | ||
| 30624060 | 2019 | Compound 20 | 8 | yGlu-(OEG)2 linker between C18 fatty acid and peptide | Amidation | Linear | Mix | Nle = Nor-leucine, DMeAsp = N-methylated D-Asp, MePhe = Methylated-phenylalanine | CCK-8 analogue | Role in the regulation of energy balance | The blood samples were collected at following time points relative to dosing: predose, 0.083, 0.25, 0.5, 0.75, 1, 1.5, 2, 3, 4, 6, 8, 10, 24, 48, 72, 96, 120, 168, 192, 216, 240, 264, and 288 h | 5 nmol/kg | 2.6 (Terminal Half Life) | Hours | 9360 | Female göttingen minipigs plasma protease | LC-MS | Female göttingen minipigs plasma | In Vivo | None | None | pEC50 = 9.14 (In Vitro CCK-1R Potency) | ||
| 30605634 | 2019 | (Pyr)1-apelin-13 | 13 | pGlu = Pyroglutamate | Free | Linear | L | None | Apelin analogs | Hemodynamic Effects In Humans | N.A. | 10 mg/kg | 3.6 | Hours | 12960 | Dogs plasma protease | LC-MS/MS | Dogs plasma | In Vivo | None | None | N.A. | ||
| 30600870 | 2019 | cot-biPEPEDB-VEGF | 20 | Acetylation | Amidation | Cyclic (C5-C13 Disulfide Bond In pepVEGF) | Mix | Lys10 linked with (OEG-Cotinine-OEG-SSSPIQGSWTWENGKWTWKGIIRLEQ-NH2), D-alanine | Synthetic | Antitumor | N.A. | 200nM | 1.18 (Clearance Half Life) | Hours | 4248 | Mice serum protease | ELISA | Mice serum | In Vivo | None | None | tumor growth inhibition was not significantly different between cot-biPEPEDB-VEGF and PBS control groups, despite a trend toward greater inhibition in the cot-biPEPEDB-VEGF group | ||
| 30521347 | 2019 | cot-APTEDB-SN38 | 26 | Free | Free | Cyclic (2 Trp-Trp Bond) | L | Lys15 linked with (Cot-Mal-PEG4-Ala-SN38) | Linker is Mal-PEG4 | Anticancer | Those mice were sacrificed at 0.08, 0.5, 1, 3, 6, 12, 24, and 48 h post injection | 1 mg/kg | 1.36 | Hours | 4896 | ICR mice plasma protease | HPLC | ICR mice plasma | In Vivo | https://sci-hub.st/10.1016/j.jconrel.2012.08.029 | None | HC[cot-APTEDB−SN38/Abcot] at an SN38/kg dose-equivalent of 2 mg effectively suppressed tumor growth and showed much greater antitumor activity (49.8% inhibition) than both cotAPTEDB-SN38 alone (23.9% inhibition) and CPT-11 (10.6% inhibition) | ||
| 30517073 | 2019 | D6.2 | 178 | Free | Free | Linear | L | V69M/I80T/F83L mutation in D6.1 | LCN-2 derivative | Tightly complexes the plant poison colchicine for use as antidote as well as bioanalytical applications | 25°C | 256 nM | 1.5 | Hours | 5400 | N.A. | Surface Plasmon Resonance (SPR) | PBS | In Vitro | Uniprot id: P80188 | None | KD(pM) = 790 | ||
| 30517073 | 2019 | EI.1 | 178 | Free | Free | Linear | L | K46M/K75X/N79M/ K142I mutations on D6.2 | LCN-2 derivative | Tightly complexes the plant poison colchicine for use as antidote as well as bioanalytical applications | 25°C | 256 nM | 3.1 | Hours | 11160 | N.A. | Surface Plasmon Resonance (SPR) | PBS | In Vitro | Uniprot id: P80188 | None | KD(pM) = 829 | ||
| 30517073 | 2019 | EI.3 | 178 | Free | Free | Linear | L | K30E/I41F/X75K/T135I/I142K mutation on El.1 | LCN-2 derivative | Tightly complexes the plant poison colchicine for use as antidote as well as bioanalytical applications | 25°C | 256 nM | 3.4 | Hours | 12240 | N.A. | Surface Plasmon Resonance (SPR) | PBS | In Vitro | Uniprot id: P80188 | None | KD(pM) = 548 | ||
| 30504081 | 2019 | VPGAG80 | 400 | A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488 | Free | Linear | L | X1 =G , X2= A | Zwitterionic polypeptide derivative | Intrinsically disordered zwitterionic polypeptides for drug delivery | 10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein | 300 μM | 5.0 ± 0.1 | Hours | 18000 | N.A. | N.A. | N.A. | In Vitro | None | None | EC50 = 10 nM for GLP1-VPGAG160 | ||
| 30504081 | 2019 | VPGAG120 | 600 | A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488 | Free | Linear | L | X1 =G , X2= A | Zwitterionic polypeptide derivative | Intrinsically disordered zwitterionic polypeptides for drug delivery | 10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein | 300 μM | 4.5 ± 0.2 | Hours | 16200 | Mice plasma protease | Fluorescence assay | Mice plasma | In Vivo | None | None | EC50 = 10 nM for GLP1-VPGAG160 | ||
| 30165247 | 2019 | PoIFN-α | 189 | Free | Free | Linear | L | None | Porcine IFN-α | Antiviral And Immune Regulatory Effects | Serum samples were collected at 0.5, 2.0, 4.0, 8.0, 12, 24,48, 72, 96, 120 and 144 h post injection | 2.5 mg/kg | 4.02 ± 0.06 | Hours | 14472 | Rats serum protease | ELISA | Rats serum | In Vivo | None | None | On MDBK cell, PoIFNα-C2 protein showed almost 10-fold lower anti-VSV activity (3.0 × 107 U/μM) than that (2.4 × 108 U/μM) of PoIFN-α standard | ||
| 30496575 | 2018 | rhIFN-λ1 | 181 | Free | Human chorionic gonadotropin β subunit carboxyl-terminal peptide (CTP) and an N-glycosylation sequence linked to its C-terminus | Linear | L | None | Recombinant human interferon-λ1 | Antiviral, Antiproliferation, And Nk Cell Cytotoxicity-Promoting Activities | Venous blood was collected at 0.5 h, 1 h, 2 h, 4 h, 8 h, and 24 h post-injection | 40 μg/kg | 3.37 ± 0.70 | Hours | 12132 | Mice blood protease | ELISA | Mice blood sample | In Vivo | None | None | Antiviral activity of the purified rhIFN-λ1 expressed by CHO cells was 2.5 × 105 IU/mg | ||
| 30411073 | 2018 | sPIF | 15 | Free | Free | Linear | L | None | Human embryo‐derived peptide analogs | Treatment Of Autoimmune Hepatitis | Patients’ serum samples were collected and analyzed at five different time points: screening (day ‐28 to day 0), pre‐injection (day 0), and postinjection days 1, 2, and 8 | 0.5 mg/kg | 63 | Minutes | 3780 | Human serum protease | LC-MS | Human serum | In Vivo | None | None | N.A. | ||
| 30411073 | 2018 | sPIF | 15 | Free | Free | Linear | L | None | Human embryo‐derived peptide analogs | Treatment Of Autoimmune Hepatitis | Patients’ serum samples were collected and analyzed at five different time points: screening (day ‐28 to day 0), pre‐injection (day 0), and postinjection days 1, 2, and 8 | 1 mg/kg | 109 | Minutes | 6540 | Human serum protease | LC-MS | Human serum | In Vivo | None | None | N.A. | ||
| 30407790 | 2018 | GENP-Gem-Ola | 12 | C18-EEG | Amidation | Linear | L | None | Synthetic | Treat Pancreatic Cancer With Breast Cancer 2 (Brca2) Mutation | Blood samples were collected at 0.5, 1, 2, 3, 5, 8, 12, and 24 h postinjection | equivalent concentrations of Gem (5 mg/kg) and Ola (50 mg/kg) | 4 | Hours | 14400 | Mice plasma protease | HPLC | Mice plasma | In Vivo | None | None | Tumors from the GENP-Gem-Ola group showed extensive apoptosis (51% c-caspase-3 positive) | ||
| 30314880 | 2018 | SA-5K | 2 | Stearic acid conjugation | Substituition of Phe with Lys at C terminal | Linear | L | chemical group (S)-3-amino-3-(1-naphthyl)-propionic acid- conjugated between R1 and Lys2 | Synthetic | Anticancer | 0, 15, 30, min, 1, 2, 6, 12, 24 h | 2 mM | 5 | Hours | 18000 | Human serum protease | HPLC, MS | Human serum | In Vitro | None | None | IC50 μM = 1.0 ± 0.05 for SA-5 in BT-474 | ||
| 30314880 | 2018 | Compound 5 | 2 | Free | Free | Linear | L | chemical group (S)-3-amino-3-(1-naphthyl)-propionic acid- conjugated between R1 and F2 | Synthetic | Anticancer, Antiproliferative | 0, 15, 30, min, 1, 2, 6, 12, 24 h | 2 mM | 2 | Hours | 7200 | Human serum protease | HPLC, MS | Human serum | In Vitro | None | None | IC50 μM = 0.895 ±0.029 for compound 5 in BT-474 | ||
| 30309736 | 2018 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | Exendin-4 | Antidiabetes | Blood samples were collected at 0, 0.25, 0.5, 0.75, 1, 2, 4, 6,8, and 12 h after injection | 100 nmoL/kg | 1.7 ± 0.3 | Hours | 6120 | SD rats serum protease | ELISA | SD rats serum | In Vivo | PDB id: 7MLL | None | EC50 values of Exendin-4, those of PE to activate GLP-1R in vitro was slightly decreased by 6.9- fold | ||
| 30170067 | 2018 | ES2-AF | 33 | ES2 | Free | Linear | L | None | Synthetic | Treatment of diseases caused by Diabetic Eye Disease, Rheumatoid Arthritis And Other Neo-Vascularization, Anti-Angiogenesis Activity | Blood samples were collected through the jugular vein at 5 min, 15 min, 30 min, 1 h, 2 h, 6 h, 12 h, 24 h, and 48 h after administration | 25 mg/kg | 2.785 | Hours | 10026 | Wistar rats plasma protease | Fluorescence spectrometry | Wistar rats plasma | In Vivo | None | None | KD (mol· L−1) = 3.011 × 10−4 | ||
| 30096651 | 2018 | Liraglutide | 31 | Free | Free | Linear | L | Lys-34 is replaced by Arg and Lys-26 is acylated with a C16 palmitic acid linkd with γGlu | GLP-1 analogs | Antidiabetes | At 1, 2, 3, 4, 6, 12, 24 and 48 h after injection, three Kunming mice were sacrificed at each time point and blood samples (~200 mL) were collected through extracting eyeball | 50 nmol/kg | 3.6 ± 0.2 | Hours | 12960 | Kunming mice plasma protease | LC-MS/MS | Kunming mice plasma | In Vivo | None | None | the potency of 6 was 5.2 times higher than liraglutide | ||
| 30096651 | 2018 | Liraglutide | 31 | Free | Free | Linear | L | Lys-34 is replaced by Arg and Lys-26 is acylated with a C16 palmitic acid linkd with γGlu | GLP-1 analogs | Antidiabetes | Blood samples (100e150 mL) were obtained from fundus venous plexus and stored in polyethylene tubes containing heparin | 50 nmol/kg | 4.2 ± 0.3 | Hours | 15120 | SD rats plasma protease | LC-MS/MS | SD rats plasma | In Vivo | None | None | the potency of 6 was 5.2 times higher than liraglutide | ||
| 30041153 | 2018 | HI | 51 | Free | Free | Cyclic (3 S-S Bond) | L | None | Synthetic | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | > 4 | Hours | 14400 | Rats SCT protease | LC-HRMS | 1 mg/ml rats SCT protein | In Vitro | https://sci-hub.st/10.1016/j.jpba.2018.07.009, PDB id: 1SF1 | None | N.A. | ||
| 30041153 | 2018 | HI | 51 | Free | Free | Cyclic (3 S-S Bond) | L | None | Synthetic | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | 3.43 | Hours | 12348 | Rats SCT protease | LC-HRMS | 2 mg/ml rats SCT protein | In Vitro | https://sci-hub.st/10.1016/j.jpba.2018.07.009, PDB id: 1SF1 | None | N.A. | ||
| 30041153 | 2018 | HI | 51 | Free | Free | Cyclic (3 S-S Bond) | L | None | Synthetic | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 50 µM | > 4 | Hours | 14400 | Rats SCT protease | LC-HRMS | 1 mg/ml rats SCT protein | In Vitro | https://sci-hub.st/10.1016/j.jpba.2018.07.009, PDB id: 1SF1 | None | N.A. | ||
| 30041153 | 2018 | HI | 51 | Free | Free | Cyclic (3 S-S Bond) | L | None | Synthetic | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 50 µM | > 4 | Hours | 14400 | Rats SCT protease | LC-HRMS | 2 mg/ml rats SCT protein | In Vitro | https://sci-hub.st/10.1016/j.jpba.2018.07.009, PDB id: 1SF1 | None | N.A. | ||
| 30041153 | 2018 | HI | 51 | Free | Free | Cyclic (3 S-S Bond) | L | None | Synthetic | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 50 µM | > 4 | Hours | 14400 | Rats SCT protease | LC-HRMS | 4 mg/ml rats SCT protein | In Vitro | https://sci-hub.st/10.1016/j.jpba.2018.07.009, PDB id: 1SF1 | None | N.A. | ||
| 30041153 | 2018 | Exenatide | 39 | Free | Amidation | Linear | L | None | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | Human SCT protease | LC-HRMS | 1 mg/ml human SCT protein | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 30041153 | 2018 | Liraglutide | 31 | Free | Free | Linear | L | Lys-34 is replaced by Arg and Lys-26 is acylated with a C16 palmitic acid linkd with γGlu | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | Human SCT protease | LC-HRMS | 1 mg/ml human SCT protein | In Vitro | None | None | N.A. | ||
| 30041153 | 2018 | Semaglutide | 31 | Free | Free | Linear | L | Aib modification at position 2, Lys26 side chain conjugated with (ADO-linker-Glu-C18) | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | 3 | Hours | 10800 | Human SCT protease | LC-HRMS | 1 mg/ml human SCT protein | In Vitro | None | None | N.A. | ||
| 30041153 | 2018 | Exenatide | 39 | Free | Amidation | Linear | L | None | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | SD rats SCT protease | LC-HRMS | 1 mg/ml SD rats SCT protein | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 30041153 | 2018 | Liraglutide | 31 | Free | Free | Linear | L | Lys-34 is replaced by Arg and Lys-26 is acylated with a C16 palmitic acid linkd with γGlu | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | SD rats SCT protease | LC-HRMS | 1 mg/ml SD rats SCT protein | In Vitro | None | None | N.A. | ||
| 30041153 | 2018 | Exenatide | 39 | Free | Amidation | Linear | L | None | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | Göttingen minipigs SCT protease | LC-HRMS | 1 mg/ml göttingen minipigs SCT protein | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 30041153 | 2018 | Liraglutide | 31 | Free | Free | Linear | L | Lys-34 is replaced by Arg and Lys-26 is acylated with a C16 palmitic acid linkd with γGlu | GLP-1 analogs | Antidiabetes | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | Göttingen minipigs SCT protease | LC-HRMS | 1 mg/ml göttingen minipigs SCT protein | In Vitro | None | None | N.A. | ||
| 30041153 | 2018 | Semaglutide | 31 | Free | Free | Linear | L | Aib modification at position 2, Lys26 side chain conjugated with (ADO-linker-Glu-C18) | GLP-1 analogs | Attenuates Renal Fibrosis | At each time point (0, 0.5, 1, 2, 4 h), 50 µL of SCts were collected from the incubation mixture | 10 µM | >4 | Hours | 14400 | Göttingen minipigs SCT protease | LC-HRMS | 1 mg/ml göttingen minipigs SCT protein | In Vitro | None | None | N.A. | ||
| 29958697 | 2018 | 125I-TLQP-21 | 21 | 125I labelled | Free | Linear | L | None | Derived from the proteolytic cleavage of the 617-aa VGF | Isoproterenol stimulated lipolysis | At the time points of 0 min, 10 min, 30 min, and 60 min, aliquots of the incubated solutions were withdrawn (15uL) | 1 mM | 110 (T1/2 Terminal Phase) | Minutes | 6600 | Rats plasma protease | LC-MS | Rats plasma | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 78 ± 2 | Minutes | 4680 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM Sialorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 94 ± 2 | Minutes | 5640 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM Opiorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 74 ± 2 | Minutes | 4440 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM [Ala2]sialorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 109 ± 8 | Minutes | 6540 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM [Ala3]sialorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 116 ± 1 | Minutes | 6960 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM [His2]opiorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 114 ± 2 | Minutes | 6840 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM [Arg2]sialorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29752565 | 2018 | Met-enkephalin | 5 | Free | Met substituition at C terminal | Linear | L | None | Synthetic | Involved in the pain modulating mechanism in the spinal cord | Incubated over 0, 30, 60, 90, 120 min at 37 °C | 0.0413 mM | 139 ± 3 | Minutes | 8340 | NEP (5.687 Nm) | RP-HPLC | Tris HCl buffer with 0.156 mM [Pro4]opiorphin inhibitor | In Vitro | None | None | N.A. | ||
| 29738954 | 2018 | CtrlTat | 11 | Acetylation | Amidation | Linear | L | None | Derived from the human immunodeficiency virus 1 (HIV-1) tat protein | Antibacterial and Anti-Tb | N.A. | 10 mM | 4 | Hours | 14400 | Trypsin | RP-HPLC | Tris-EDTA buffer | In Vitro | None | None | MIC (micromolar) = 6.27 ± 0.05 for E.coli | ||
| 29685037 | 2018 | Ang-AA | 7 | Acetylation | Amidation | Linear | L | None | Ang-(1-7) analogs | Antifibrosis, Antihypertension, Antihypertrophic and Antiarrhythmia Activities | 15 h at 37°C | 100 µM | 171.1 ± 40.7 | Minutes | 10266 | Rats serum protease | HPLC | Rats serum | In Vitro | None | None | Ang-AA in combination with paclitaxel exerted stronger anti-tumor effects than Ang-(1-7), as indicated by reduced tumor growth, tumor weight, COX2 expression, and increased survival of the mice | ||
| 29685037 | 2018 | Ang-AA | 7 | Acetylation | Amidation | Linear | L | None | Ang-(1-7) analogs | Antifibrosis, Antihypertension, Antihypertrophic and Antiarrhythmia Activities | After a 30 min incubation at 37°C | 0.1 mM | 135.7 ± 37.7 | Minutes | 8142 | ACE, LAP and NEP | HPLC | PBS solution containing all three hydrolytic enzymes (0.5 IU/mL), ACE, LAP and NEP | In Vitro | None | None | Ang-AA in combination with paclitaxel exerted stronger anti-tumor effects than Ang-(1-7), as indicated by reduced tumor growth, tumor weight, COX2 expression, and increased survival of the mice | ||
| 29685037 | 2018 | Ang-AA | 7 | Acetylation | Amidation | Linear | L | None | Ang-(1-7) analogs | Antifibrosis, Antihypertension, Antihypertrophic and Antiarrhythmia Activities | At 2, 4, 6, 8, 10, 15, 50, 120, 240, 480, 720 and 960 min after the injection, 100 µL of blood were sampled from each animal through the caudal vein | 400 µg/kg | 238.7 ± 61.3 | Minutes | 14322 | Rats serum protease | RP-HPLC | Rats serum | In Vivo | None | None | Ang-AA in combination with paclitaxel exerted stronger anti-tumor effects than Ang-(1-7), as indicated by reduced tumor growth, tumor weight, COX2 expression, and increased survival of the mice | ||
| 29673717 | 2018 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | GLP-1 analogs | Antidiabetes | At 0, 1, 2, 4, 6, 8, 12, 24, 36, 48 and 72 h time points | 1000 ng/mL | 3.6 | Hours | 12960 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vitro | PDB id: 7MLL | None | EC50 (pM) = 1.8 ± 0.8 | ||
| 29669811 | 2018 | 125I-3E8.G4S dimer | 561 | 125I labelled | Free | Linear | L | 125I-labeled, 2 ScFv joined by G4S linker | Derived from the 3E8 antibody | Optimizes biophysical properties, serum half-life and high-specificity tumor imaging | Blood samples (5 μl) were drawn from the saphenous vein by puncture, using a 30-gauge syringe needle, at 0.5, 1, 5, 24, 48, and 72 h postinjection for 3E8.G4S | 5 μCi | 2 | Hours | 7200 | Mice blood protease | Radioiodination assay | Mice blood sample | In Vivo | None | None | KD of 3.6 nM for 3E8.G4S | ||
| 29669811 | 2018 | 125I-3E8.G4S oligomer (Trimeric) | 844 | 125I labelled | Free | Linear | L | 125I-labeled, 3 ScFv joined by G4S linker | Derived from the 3E8 antibody | Optimizes biophysical properties, serum half-life and high-specificity tumor imaging | 0.5, 1.5, 3, 6, 24, 48, and 72 h | 5 μCi | 3.3 | Hours | 11880 | Mice blood protease | Radioiodination assay | Mice blood sample | In Vivo | None | None | KD of 3.6 nM for 3E8.G4S | ||
| 29669811 | 2018 | 125I-3E8.G4S oligomer (Tetrameric) | 1127 | 125I labelled | Free | Linear | L | 125I-labeled, 4 ScFv joined by G4S linker | Derived from the 3E8 antibody | Optimizes biophysical properties, serum half-life and high-specificity tumor imaging | 0.5, 1.5, 3, 6, 24, 48, and 72 h | 5 μCi | 3.3 | Hours | 11880 | Mice blood protease | Radioiodination assay | Mice blood sample | In Vivo | None | None | KD of 3.6 nM for 3E8.G4S | ||
| 29540315 | 2018 | GUB09-145 | 34 | Free | Amidation | Linear | L | Lipidation at Lys14 (C16-yE-) | GUB09-123 analogue | GLP-1/GLP-2 co-agonist | Blood samples were collected by decapitation of the animals at nine different time points after administration (0.25, 0.5, 0.75, 1, 2, 4, 6, 10 and 24 hours, n=3 for each time point) | 800nmol/kg | 2.7 | Hours | 9720 | Mice plasma protease | LC-MS/MS | Mice plasma | In Vivo | None | None | GLP-1R, EC50 (nM) = 0.17 | ||
| 29528634 | 2018 | GLP-2 analog 8 | 42 | Free | Amidation | Cyclic (C17-C24 Stapled Using Linker L3) | L | None | GLP-2 analogues | Efficacy in Dextran Sodium Sulfate induced Mouse Colitis Models | Plasma levels of the peptides at various time points (5 min, 30 min, 1 h, 3 h, 7 h, and 24 h) | 10 nmol/kg | 2.7 | Hours | 9720 | Mice plasma protease | In vitro cell based activity assay | Mice plasma | In Vivo | None | None | EC50(nM) = 0.068 ± 0.003 | ||
| 29528634 | 2018 | GLP-2 analog 9 | 42 | Free | Amidation | Cyclic (C9-C16 Stapled Using Linker L3) | L | None | GLP-2 analogues | Efficacy in Dextran Sodium Sulfate induced Mouse Colitis Models | Plasma levels of the peptides at various time points (5 min, 30 min, 1 h, 3 h, 7 h, and 24 h) | 10 nmol/kg | 3.1 | Hours | 11160 | Mice plasma protease | In vitro cell based activity assay | Mice plasma | In Vivo | None | None | EC50(nM) = 0.041 ± 0.005 | ||
| 29528634 | 2018 | GLP-2 analog 10 | 42 | Free | Amidation | Cyclic (C11-C18 Stapled Using Linker L3) | L | None | GLP-2 analogues | Efficacy in Dextran Sodium Sulfate induced Mouse Colitis Models | Plasma levels of the peptides at various time points (5 min, 30 min, 1 h, 3 h, 7 h, and 24 h) | 10 nmol/kg | 4.7 | Hours | 16920 | Mice plasma protease | In vitro cell based activity assay | Mice plasma | In Vivo | None | None | EC50(nM) = 0.028 ± 0.002 | ||
| 29517911 | 2018 | 1b | 18 | Replaced the Nterminal Ala with an acetyl group | Cterminal extension following the C-terminal alanine composed of 3 sarcosines and 2 D-arginine residues | Bicyclic (Cyclized On C1, C8, C15 By 1,3,5 Trismethylbenzene) | Mix | None | 1a analogue | Antidiabetes (Treatment of Diabetic Macular Edema) | Serial blood samples were taken from each animal via temporary indwelling tail vein cannulae at 5, 10, 20, 30, 60, 120, 180, and 240 min postdose, | 5 mg/kg | 78 | Minutes | 4680 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vivo | None | None | Ki Values (nM) = 3.4 ± 1.1 against PKal from Rats | ||
| 29517911 | 2018 | 2b | 13 | Free | Free | Bicyclic (Cyclized On C1, C7, C13 By 1,3,5 Trismethylbenzene) | L | None | 2a analogue | Antidiabetes (Treatment of Diabetic Macular Edema) | 24 h at 37 °C | 0.16 mM | 1.5 | Hours | 5400 | Mouse plasma protease | LC-MS/MS | Mouse plasma | In Vitro | None | None | Ki Values (nM) = 2.0 ± 0.9 against PKal from Rats | ||
| 29517911 | 2018 | 2b | 13 | Free | Free | Bicyclic (Cyclized On C1, C7, C13 By 1,3,5 Trismethylbenzene) | L | None | 2a analogue | Antidiabetes (Treatment of Diabetic Macular Edema) | 24 h at 37 °C | 0.16 mM | 2.8 | Hours | 10080 | Rats plasma protease | LC-MS/MS | Rats plasma | In Vitro | None | None | Ki Values (nM) = 2.0 ± 0.9 against PKal from Rats | ||
| 29464007 | 2018 | 99mTc-F1A | 18 | 99mTc-HHEDEG | Free | Cyclic (C-C Disulfide Bond In C Terminal) | L | Interconnected through a diethylene glycol (DEG) spacer | Fibrin-specific natural peptide analogue | 99MTC-F4A is a high-avidity prototype probe for characterizing thrombus in Lvads | Serial blood samples were obtained at 0, 2, 5, 10, 15, 20, 30, 60, 120, and 180 min via an indwelling jugular catheter | N.A. | 124.7 ± 41.3 (T1/2b Elimination Half Life) | Minutes | 7482 | Mice plasma protease | Radioactivity assay | Mice plasma | In Vivo | None | None | 99mTc-F4A probe was not displaced by F1A | ||
| 29464007 | 2018 | 99mTc-F1A | 18 | 99mTc-HHEDEG | Free | Cyclic (C-C Disulfide Bond In C Terminal) | L | Interconnected through a diethylene glycol (DEG) spacer | Fibrin-specific natural peptide analogue | 99MTC-F4A is a high-avidity prototype probe for characterizing thrombus in Lvads | Serial blood samples were obtained at 0, 2, 5, 10, 15, 20, 30, 60, 120, and 180 min via an indwelling jugular catheter | N.A. | 174.2 ± 26.2 (T1/2b Elimination Half Life) | Minutes | 10452 | Mice plasma protease | Radioactivity assay | Mice plasma | In Vivo | None | None | Kd ~10.2 µM for 99mTc-F1A (bound to uniform fibrin clots in PBS) | ||
| 29461833 | 2018 | Pyr analogue 3 | 13 | pGlu = Pyroglutamate | Free | Cyclic (Rx2-X6 Bond) | L | X= allylglycine, Rx=Na-ally-arginine, Nle = Nor-leucine | Pyr-13 analogue | Effects on Cardiac and Renal Functions as well as survival in a Systemic Inflammation Model Of Sepsis and Septic Shock | At selected time points (0, 2, 4, 7, and 24 h or 0, 10, 20, 60, and 120 min). | 1 mM | 2.2 ± 0.3 | Hours | 7920 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Ki binding (nM) = 4.5 ±1.4 for 3 | ||
| 29461833 | 2018 | Pyr analogue 5 | 13 | pGlu = Pyroglutamate | Free | Cyclic (X3-X7 Bond) | L | X= allylglycine, Nle = Nor-leucine | Pyr-13 analogue | Effects on Cardiac and Renal Functions as well as survival in a Systemic Inflammation Model Of Sepsis and Septic Shock | At selected time points (0, 2, 4, 7, and 24 h or 0, 10, 20, 60, and 120 min). | 1 mM | 3.9 ± 0.6 | Hours | 14040 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Ki binding (nM) = 3 ±0.1 for 5 | ||
| 29461833 | 2018 | Pyr analogue 8 | 13 | pGlu = Pyroglutamate | Free | Cyclic (X5-X9 Bond) | L | X= allylglycine, Nle = Nor-leucine | Pyr-13 analogue | Effects on Cardiac and Renal Functions as well as survival in a Systemic Inflammation Model Of Sepsis and Septic Shock | At selected time points (0, 2, 4, 7, and 24 h or 0, 10, 20, 60, and 120 min). | 1 mM | 3.5 ± 0.8 | Hours | 12600 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Ki binding (nM) = 3.9 ±1.4 for 8L | ||
| 29461833 | 2018 | Pyr analogue 10 | 13 | pGlu = Pyroglutamate | Free | Cyclic (X6-X10 Bond) | L | X= allylglycine, Nle = Nor-leucine | Pyr-13 analogue | Effects on Cardiac and Renal Functions as well as survival in a Systemic Inflammation Model Of Sepsis and Septic Shock | At selected time points (0, 2, 4, 7, and 24 h or 0, 10, 20, 60, and 120 min). | 1 mM | 4.1 ±0.8 | Hours | 14760 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Ki binding (nM) = 194 ±70 for 10L | ||
| 29461833 | 2018 | Pyr analogue 12 | 13 | pGlu = Pyroglutamate | Free | Cyclic (X8-X12 Bond) | L | X= allylglycine, Nle = Nor-leucine | Pyr-13 analogue | Effects on Cardiac and Renal Functions as well as survival in a Systemic Inflammation Model Of Sepsis and Septic Shock | At selected time points (0, 2, 4, 7, and 24 h or 0, 10, 20, 60, and 120 min). | 1 mM | 4.6 ±0.7 | Hours | 16560 | Rats plasma protease | UPLC-MS | Rats plasma | In Vitro | None | None | Ki binding (nM) = 14 ±7 for 12 | ||
| 29436835 | 2018 | Palm-PIE12-trimer | 48 | Palm-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 5 min to 24 h | 1.2 mg/kg | 1.8 | Hours | 6480 | Rats plasma protease | LC-MS/MS using an Agilent HPLC | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.54 ± 0.029 (antiviral potency) | ||
| 29436835 | 2018 | Palm-PIE12-trimer | 48 | Palm-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 15 min to 48 h | 1.2 mg/kg | 2.2 | Hours | 7920 | Rats plasma protease | LC-MS/MS using an Agilent HPLC | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.54 ± 0.029 (antiviral potency) | ||
| 29436835 | 2018 | C16-PIE12-trimer | 48 | C16-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 15 min to 48 h | 1 mg/kg | 1.2 | Hours | 4320 | Rats plasma protease | LC-MS/MS using an Agilent HPLC | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.11 ± 0.012 (antiviral potency) | ||
| 29436835 | 2018 | C18-PIE12-trimer | 48 | C18-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 5 min to 24 h | 1 mg/kg | 1.1 | Hours | 3960 | Rats plasma protease | LC-MS/MS using an Agilent HPLC | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.087 ± 0.012(antiviral potency) | ||
| 29436835 | 2018 | C18-PIE12-trimer | 48 | C18-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 15 min to 48 h | 1 mg/kg | 1.4 | Hours | 5040 | Rats plasma protease | LC-MS/MS using an Agilent HPLC | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.087 ± 0.012(antiviral potency) | ||
| 29436835 | 2018 | Chol-PIE12-trimer | 48 | Chol-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 5 min to 24 h | 1 mg/kg | 1.8 | Hours | 6480 | Rats plasma protease | UHPLC coupled with Quadrupole Time-of-Flight (Q-TOF) Mass Spectrometry | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.022 ± 0.0018 (antiviral potency) | ||
| 29436835 | 2018 | Chol-PIE12-trimer | 48 | Chol-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 15 min to 48 h | 1 mg/kg | 2.7 | Hours | 9720 | Rats plasma protease | UHPLC coupled with Quadrupole Time-of-Flight (Q-TOF) Mass Spectrometry | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.022 ± 0.0018 (antiviral potency) | ||
| 29436835 | 2018 | Chol-PIE12-trimer | 48 | Chol-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 5 min to 24 h | 1 mg/kg | 1.6 | Hours | 5760 | Rats plasma protease | UHPLC coupled with Quadrupole Time-of-Flight (Q-TOF) Mass Spectrometry | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.022 ± 0.0018 (antiviral potency) | ||
| 29436835 | 2018 | Chol-PIE12-trimer | 48 | Chol-Maleimide joined by linker PEG24 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 15 min to 48 h | 1 mg/kg | 3.9 | Hours | 14040 | Rats plasma protease | UHPLC coupled with Quadrupole Time-of-Flight (Q-TOF) Mass Spectrometry | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.022 ± 0.0018 (antiviral potency) | ||
| 29436835 | 2018 | CPT31 | 48 | Chol-Maleimide joined by linker PEG31 | Free | Linear | Mix | All D-amino acids except Gly | Synthetic | Antiviral (HIV Entry Inhibitor) | 5 min to 24 h | 1 mg/kg | 3.3 | Hours | 11880 | Rats plasma protease | Ultra-High Performance Liquid Chromatography (UHPLC) | Rats plasma | In Vivo | None | None | JRFL(nM) = 0.015 ± 0.0062 (antiviral potency) | ||
| 29433929 | 2018 | CT105 | 38 | Amidation | Acetylation | Linear | L | None | Synthetic | Antiviral (against HIV Virus) | Serial blood samples were collected from each animal before injection and at 0.08, 0.25, 0.5, 1, 2, 4 and 8 h after injection | 6 mg/kg | 2.7 | Hours | 9720 | Rats plasma protease | IC-ELISA | Rats plasma | In Vivo | None | None | IC50(nM) =0.26 against HIV variant R3A | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | Day 1 (cycle 1 - 28days) | 6 mg/m2 | 2.3 | Hours | 8280 | Human plasma protease | ELISA | Human plasma | In Vivo | https://www.lens.org/lens/patent/124-764-042-412-641/fulltext?l=en | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 1 (cycle 1 - 28days) | 12 mg/m2 | 2.1 | Hours | 7560 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 1 (cycle 1 - 28days) | 24 mg/m2 | 3.2 | Hours | 11520 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 1 (cycle 1 - 28days) | 48 mg/m2 | 4.9 | Hours | 17640 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 29 (Cycle 2 day1) | 6 mg/m2 | 2.8 | Hours | 10080 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 29 (Cycle 2 day1) | 12 mg/m2 | 2 | Hours | 7200 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 29 (Cycle 2 day1) | 24 mg/m2 | 3.7 | Hours | 13320 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29423221 | 2018 | dTCApFs | 14 | Free | Free | Linear | D | None | Synthetic | Anticancer | day 29 (Cycle 2 day1) | 48 mg/m2 | 4.6 | Hours | 16560 | Human plasma protease | N.A. | Human plasma | In Vivo | None | None | N.A. | ||
| 29421564 | 2018 | SP | 11 | Free | Free | Linear | L | None | Synthetic | Therapeutic Regeneration By Facilitating Mobilization Of Endogenous Stem Cells From Bone Marrow To The Injured Sites | 0 to 72 h at 37°C | 5 nmol | 5 | Minutes | 18000 | Diabetic rats serum protease | ELISA | Diabetic rats serum | In Vitro | None | None | N.A. | ||
| 29335522 | 2018 | PAK2 | None | N.A. | N.A. | N.A. | N.A. | N.A. | Synthetic | Role in PDAC cancer invasion and metastasis | N.A. | N.A. | 4.5 | Hours | 16200 | Miapaca-2 cell lysate protease | Western blotting | Miapaca-2 cells lysate after PKM2 depletion (treated with 20 μg/ml cycloheximide (CHX)) | In Vitro | None | None | N.A. | ||
| 29329072 | 2018 | Compound 2 | 8 | Acetylation | Amidation | Linear | L | None | NMU-analogs | Regulation of Feeding Behavior, the stress response and nociception | 37 °C | 112 µM | 117.8 ± 0.7 | Minutes | 7068 | Human plasma protease | RP-HPLC | Human plasma | In Vitro | None | None | N.A. | ||
| 29329072 | 2018 | Compound 16 | 7 | Acetylation, 7-OH-Tic = 7-hydroxy-L-1,2,3,4- tetrahydroisoquinoline-3-carboxylic acid at position 1 | Amidation | Linear | L | None | NMU-analogs | Regulation of Feeding Behavior, the stress response and nociception | 37 °C | 112 µM | 109.8 ± 3.1 | Minutes | 6588 | Human plasma protease | RP-HPLC | Human plasma | In Vitro | None | None | EC50(nM) = 5.1, IC50(nM) = 0.037 for hNMUR1 and EC50(nM) = 13.4, IC50(nM) = 12.3 for hNMUR2 | ||
| 29329072 | 2018 | Compound 18 | 8 | Ac-2'NaI = 2’-naphtylalanine at position 1 | Amidation | Linear | L | None | NMU-analogs | Regulation of Feeding Behavior, the stress response and nociception | 37 °C | 112 µM | 128.8 ± 1.7 | Minutes | 7728 | Human plasma protease | RP-HPLC | Human plasma | In Vitro | None | None | EC50(nM) = 1.6, IC50(nM) = 0.88 for hNMUR1 and EC50(nM) = 1.6, IC50(nM) = 5.6 for hNMUR2 | ||
| 29329072 | 2018 | Compound 28 | 8 | Acetylation | Amidation | Linear | L | Dmt = 2',6'-dimethyltyrosine at position 4 | NMU-analogs | Regulation Of Feeding Behavior, The Stress Response And Nociception | 37 °C | 112 µM | 253.5 ± 6 | Minutes | 15210 | Human plasma protease | RP-HPLC | Human plasma | In Vitro | None | None | EC50(nM) = 7.7, IC50(nM) = 0.36 for hNMUR1 and EC50(nM) = 3675, IC50(nM) = 1857 for hNMUR2 | ||
| 29141139 | 2018 | 22A | 22 | Free | Free | Linear | L | None | ApoA-I mimetic peptide | Treatment of Cardiovascular Diseases | At pre-dose and 0.25, 0.5, 1, 2, 4, 8, 24 and 48 hours after dosing | 20 mg/mL | 4.588 | Hours | 16516.8 | Rats serum protease | LC-MS | Rats serum after 50 mg/kg sHDL | In Vivo | None | None | N.A. | ||
| 29141139 | 2018 | 22A | 22 | Free | Free | Linear | L | None | ApoA-I mimetic peptide | Treatment of Cardiovascular Diseases | At pre-dose and 0.25, 0.5, 1, 2, 4, 8, 24 and 48 hours after dosing | 20 mg/mL | 4.25 | Hours | 15300 | Rats serum protease | LC-MS | Rats serum after 2.5 mg/kg sHDL-PEG2k | In Vivo | None | None | N.A. | ||
| 29104145 | 2018 | AS16-Fc | 7 | Free | Fc | Linear | L | None | Fusion protein of AS16 and Fc | Antitumor | Blood samples were taken at 0 min, 5min,30 min, 2 h, 4 h, 6 h, 8 h, 10 h and 24h from orbit | 45 mg/kg | 231 | Minutes | 13860 | Rats serum protease | ELISA | Rats serum | In Vivo | https://sci-hub.st/10.1016/j.peptides.2010.01.007 | None | The activity value of AS16-Fc, as observed in vivo, is its significant inhibition of tumor growth and reduction in M2-polarized macrophages and vessel density in the MCA-205 tumor model | ||
| US 201615754342 A | 2018 | Prior Art analogue 2 | 50 | Free | B29K(N(Eps)Tetradecanedioyl-gGlu-2xOEG), desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A and B chain linked with disulfide bond,B28D,modifications | Insulin Derivative | Treatment of Hypoglycaemia | Blood sample was collected at predose(-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1 nmol/kg | 121 | Minutes | 7260 | Pig plasma protease | ELISA | Pig plasma | In Vivo | None | US 201615754342 A | N.A. | ||
| US 201615754342 A | 2018 | Prior Art analogue 2 | 50 | Free | B29K(N(Eps)Tetradecanedioyl-gGlu-2xOEG), desB30 modifications | Cyclic (C7-C12 disulfide bond in A chain) | L | A and B chain linked with disulfide bond,B28D, modifcations | Insulin Derivative | Treatment of Hypoglycaemia | Blood sample was collected at predose(-10,0),3,6,9,12,15,20,30,45,60,90,120,150,180,240,300,360,420,480,540,600 And 720 Minutes | 1 nmol/kg | 159 | Minutes | 9540 | Pig plasma protease | ELISA | Pig plasma | In Vivo | None | US 201615754342 A | N.A. | ||
| US 201615754342 A | 2018 | Example 15 | 49 | Free | B29K(N(Eps)Hexadecanedioyl-gGlu-2×OEG), desB30 modifications | cyclic (C7-C12 disulfide bond in A chain) | L | A and B chain linked with disulfide bond,A21A, B3E, desB27, modificaitons | Insulin Derivative | Treatment Of Hypoglycaemia | Plasma was collected at the time points 0, 3,7,15,30,60,120,180 minutes after dosing | 25 nmol/kg | 67 | Minutes | 4020 | SD rats plasma protease | ELISA | SD rats plasma with Zinc Ion | In Vivo | None | US 201615754342 A | Lipogenesis 1% HSA (%rel to HI) = 1.8 | ||
| US 201615754342 A | 2018 | Prior Art analogue 7 | 50 | Free | B29K(N(Eps)Hexadecanedioyl-gGlu), desB30 modifications | cyclic (C7-C12 disulfide bond in A chain) | L | A and B chain linked with disulfide bond,modifications | Insulin Derivative | Treatment Of Hypoglycaemia | Plasma was collected at the time points 0, 3,7,15,30,60,120,180 minutes after dosing | 25 nmol/kg | 200 | Minutes | 12000 | SD rats plasma protease | ELISA | SD rats plasma with 3 Zinc Ion Per Hexamer | In Vivo | None | US 201615754342 A | N.A. | ||
| 29029327 | 2017 | Alu-HCG | 31 | Free | HCG | Linear | L | None | Derived from the exonization of an Alu-J element in the glycoprotein hormone alpha (GPHA) gene | Role in Placental development | N.A. | 2 mg/ml | 82.3 | Minutes | 4938 | Rats serum protease | ELISA | Rats serum | In Vivo | None | None | N.A. | ||
| 28932995 | 2017 | rE-4 | 39 | Free | Deamidation at C terminal | Linear | L | None | Exendin-4 analogs | GLP-1R agonist | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 1 | 5 µg | 1.8 | Hours | 6480 | Human plasma protease | ELISA | Human plasma | In Vivo | None | None | N.A. | ||
| 28932995 | 2017 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | Synthetic | Antidiabetes | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 1 | 5 µg | 1.6 | Hours | 5760 | Human plasma protease | ELISA | Human plasma | In Vivo | PDB id: 7MLL | None | N.A. | ||
| 28932995 | 2017 | rE-4 | 39 | Free | Deamidation at C terminal | Linear | L | None | Exendin-4 analogs | GLP-1R agonist | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 1 | 5 µg | 1.8 | Hours | 6480 | Human plasma protease | ELISA | Human plasma with Metformin | In Vivo | None | None | N.A. | ||
| 28932995 | 2017 | rE-4 | 39 | Free | Deamidation at C terminal | Linear | L | None | Exendin-4 analogs | GLP-1R agonist | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 8 | 5 µg | 1.9 | Hours | 6840 | Human plasma protease | ELISA | Human plasma | In Vivo | None | None | N.A. | ||
| 28932995 | 2017 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | Synthetic | Antidiabetes | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 8 | 5 µg | 1.3 | Hours | 4680 | Human plasma protease | ELISA | Human plasma | In Vivo | PDB id: 7MLL | None | N.A. | ||
| 28932995 | 2017 | rE-4 | 39 | Free | Deamidation at C terminal | Linear | L | None | Exendin-4 analogs | GLP-1R agonist | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 8 | 5 µg | 1.9 | Hours | 6840 | Human plasma protease | ELISA | Human plasma with Metformin | In Vivo | None | None | N.A. | ||
| 28932995 | 2017 | rE-4 | 39 | Free | Deamidation at C terminal | Linear | L | None | Exendin-4 analogs | GLP-1R agonist | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 84 | 10 µg | 1.6 | Hours | 5760 | Human plasma protease | ELISA | Human plasma | In Vivo | None | None | N.A. | ||
| 28932995 | 2017 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | Synthetic | Antidiabetes | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 84 | 10 µg | 1.8 | Hours | 6480 | Human plasma protease | ELISA | Human plasma | In Vivo | PDB id: 7MLL | None | N.A. | ||
| 28932995 | 2017 | rE-4 | 39 | Free | Deamidation at C terminal | Linear | L | None | Exendin-4 analogs | GLP-1R agonist | Blood samples for pharmacokinetic evaluation of rE-4 and exenatide were collected at specified times (0, 0.25, 0.5,0.75, 1, 1.5, 2, 3 and 4 h) on days 84 | 10 µg | 1.3 | Hours | 4680 | Human plasma protease | ELISA | Human plasma | In Vivo | None | None | N.A. | ||
| 28821462 | 2017 | wtFN | 183 | Free | Free | Linear | L | Cy5 dye (Lumiprobe) were chemically conjugated to the amine groups of lysine residues on the exterior surface of the nanocages | Synthetic | Antitumor | N.A. | 50 mg/kg | 1.1 ± 0.1 | Hours | 3960 | Mice plasma protease | Fluorescence assay | Mice plasma | In Vivo | PDB id: 1FHA | None | N.A. | ||
| 28821462 | 2017 | LCFN36 | 183 | Free | Fusing the XTEN peptide of 36 amino acids through a linker | Linear | L | Gly-rich linker (GSSGGSGSSGGSGGGDEADGSRGSQKAGVDE) is used, Cy5 dye (Lumiprobe) were chemically conjugated to the amine groups of lysine residues on the exterior surface of the nanocages | wtFN derivative | Antitumor | N.A. | 50 mg/kg | 3.5 ± 0.3 | Hours | 12600 | Mice plasma protease | Fluorescence assay | Mice plasma | In Vivo | None | None | N.A. | ||
| 28771355 | 2017 | GLP-1 analogue 6 | 31 | Free | Diflunisal is linked to the GLP-1 peptide through its hydroxyl group | Linear | L | K34R substituition at GLP-1, at Lys20 indomethacin is linked through a γGlu residue-Lys, DIF=diflunisal, Dehydroxylation of DIF | GLP-1 analogs | Antidiabetes | Blood sampled at eight time-points within 24 h | 5 mL/kg | 299 | Minutes | 17940 | Lean mice plasma protease | Luminescent Oxygen Channeling Immunoassay | Lean mice plasma | In Vivo | None | None | GLP-1R EC50 ± SEM (nM) = 0.547 ± 0.211 | ||
| 28721592 | 2017 | G-CSF | 204 | Met addition at N terminal of G-CSF | Free | Linear | L | None | Human derived | Selectively stimulate proliferation | Blood samples were drawn from the rats at selected time points (0, 3, 6, 12, 18, and 24 h after injection) | 150 μg/kg | 1.2 | Hours | 4320 | Rats serum protease | ELISA | Rats serum | In Vivo | Genbank accession no. NM_172219 | None | in vitro activity of GCSF-La reached 48% of that of the G-CSF monomer | ||
| 28714475 | 2017 | tagPK128 | 22 | tag | Free | Bicyclic(C9-C15,C15-C21 Disulfide Bond In Pk128) | L | Lys4 linked with Palm fatty acid | Synthetic | Inhibit plasma kallikrein | N.A. | 0.5 mg/kg | 2.9 ± 0.7 (T1/2b) | Hours | 10440 | Rats plasma protease | RP-HPLC using a fluorescence detector | Rats plasma | In Vivo | None | None | Albumin binding (Kd) (nM) = 720±90 for rat albumin | ||
| 28714475 | 2017 | Tag | 7 | Fluorescein (F) | Amidation | Linear | L | Lys4 linked with Palm fatty acid | Synthetic | Increases Half Life | N.A. | 0.25 mg/kg | 1.5 ± 0.4 (T1/2a) | Hours | 5400 | Rats plasma protease | RP-HPLC using a fluorescence detector | Rats plasma | In Vivo | None | None | Albumin binding (Kd) (nM) = 220±30 for rat albumin | ||
| 28668697 | 2017 | Exendin-4 | 39 | Free | Amidation | Linear | L | None | GLP-1 analogs | Antidiabetes | Blood samples (approximately 100 µL) were collected from the lateral tail vein at 0, 0.25, 0.5, 0.75, 1, 1.5, 2, 3, 4, 6, 8, 12 and 16 h | 50 nmol | 2.35 ± 0.23 (Elimination Half Life) | Hours | 8460 | SD rats plasma protease | LC-MS/MS | SD rats plasma | In Vivo | None | None | EC50(nM) = 1.79 ± 0.47 (EC50 values represent the concentration (nM) of agonists to simulate half-maximum GLP-1 receptor cAMP activation) | ||
| 28668697 | 2017 | 7b | 29 | Free | Free | Linear | L | X2 = Structure given in paper, n= 40 | Derived from Xenopus GLP-1 | Antidiabetes | Blood samples (approximately 100 µL) were collected from the lateral tail vein at 0, 0.25, 0.5, 0.75, 1, 1.5, 2, 3, 4, 6, 8, 12 and 16 h | 50 nmol | 2.78 ± 0.14 (Elimination Half Life) | Hours | 10008 | SD rats plasma protease | LC-MS/MS | SD rats plasma | In Vivo | None | None | EC50 (nM) = 1.4 ± 0.2 for peptide 7 (potency on the cloned human GLP-1 receptor) | ||
| 28522195 | 2017 | [Gly2]GLP-2 | 33 | Free | Free | Linear | L | Ala2 to Gly2 | GLP-2 analogue | Treatment of Short Bowel Syndrome | Blood samples were collected from the tail vein at 0, 1, 2, 3, 4, 5,6, 9 and 12 h after administration | 2 mg/mL | 1.62 (Terminal Half Life) | Hours | 5832 | Rats plasma protease | N.A. | Rats plasma | In Vivo | None | None | EC50 values of [Gly2]GLP-2 = 8.40 nM | ||
| 28522195 | 2017 | native GLP-2 | 33 | Free | Free | Linear | L | None | Glucagon | Treatment of Short Bowel Syndrome | Blood samples were collected from the tail vein at 0, 1, 2, 3, 4, 5,6, 9 and 12 h after administration | 2 mg/mL | 4.59 (Terminal Half Life) | Hours | 16524 | Rats plasma protease | N.A. | Rats plasma | In Vivo | None | None | EC50 values of GLP-2 = 2.58 nM | ||
| 28457895 | 2017 | Exenatide-APTHSA | 83 | Free | C-terminal part of exenatide was connected to the N-terminal part of APTHSA using a long (18-mer) linker | Linear | L | None | Exendin-4 analogs | Antihyperglycemic | 1 hour | 25 nmol/kg | ~1.3 | Hours | 4680 | ICR mice retro-orbital sinus protease | Exenatide ELISA | ICR mice retro-orbital sinus | In Vivo | PDB id: 7MLL | None | both exenatide and exenatide-APTHSA groups at an equal dose effectively cleared glucose from the bloodstream, showing similar anti-hyperglycemic activity | ||
| 28437610 | 2017 | Native Ex4 | 39 | Free | Amidation | Linear | L | None | GLP-1 analogs | Antidiabetes | N.A. | 25 nmol/kg | 1.9 | Hours | 6840 | Murine plasma protease | ELISA | Murine plasma | In Vivo | PDB id: 7MLL | None | N.A. | ||
| 28416744 | 2017 | cRGD-ZW800-1 | 5 | Free | ZW800-1 fluorophore | Cyclic (RGDyK) | Mix | y = D-Tyr | Synthetic | Generic tracer for Intraoperative Near-Infrared Fluorescence Imaging of Solid Tumors | Time points -5, 1, 6, 10, 20, 30, 40, 50, 60, 90, 120, and 240 min. post injection | 10 nmol | 71.1 ± 9.4 (Terminal Half Life) | Minutes | 4266 | Mice serum protease | Fluorescence assay | Mice serum | In Vivo | None | None | In vitro competition for binding cRGD-ZW800-1 (500 nM) with a 1:1 molar ratio of unlabeled cRGD (500 nM) resulted in a reduction of 32% on the HT-29 cells and 36% on the high integrin-expressing U-87 MG cells compared to cells treated without unlabeled cRGD | ||
| 28356733 | 2017 | DBAYL | 32 | Free | Free | Linear | L | None | PACAP-derived peptide | Antidiabetes | Orbital blood was collected at each time point before dosing and from 0.5 to 24 h post dosing | 1 mg/kg | 1.98 | Hours | 7128 | DB/DB mice orbital blood protease | LC-MS/MS | DB/DB mice orbital blood sample | In Vivo | None | None | EC50 of DBAYL at VPAC1 was 804 nM | ||
| 28323965 | 2017 | r-HGH | 191 | Free | Free | Linear | L | None | Synthetic | Treatment of GHD | Measured following 2 weeks of daily administration | 0.24 mg/kg | 3.5 | Hours | 12600 | Human serum protease | IDS-iSys chemiluminescence assay | Human serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU, https://sci-hub.se/10.1021/acs.molpharmaceut.5b00868 | None | EC50 = 0.36 ± 0.06 ng/ml (Proliferation of BAFB2B2 cells) | ||
| 28209419 | 2017 | Native GLP-2 | 33 | Free | Free | Linear | L | None | Glucagon | Treatment of Short Bowel Syndrome | N.A. | 8 μg/kg | ~120 | Minutes | 7200 | Human plasma protease | GLP-2 (1–33) specific radioimmunoassay | Adult human plasma | In Vivo | PDB id: 2L63 | None | N.A. | ||
| 28138743 | 2017 | Indolicidin | 13 | Free | Amidation | Linear | L | None | Synthetic | Antimicrobial | A plasma aliquot was withdrawn at each time-point(0, 0.16, 0.5, 1, 2, 4 h) | 10 μM | 1.53 | Hours | 5508 | Mouse plasma protease | LC-HRMS. | Mouse plasma | In Vitro | None | None | N.A. | ||
| 28097629 | 2017 | PEG20k-Cys14-TP508 | 23 | Free | Amidation | Linear | L | PEGylation at Cys14 through Mal-modified PEG20K, TAMRA-labeled | Synthetic | Treatment of Diabetic Foot Ulcers | N.A. | Molar equivalent of 5 mg/mL TP508 | 70 | Minutes | 4200 | Male CD1 mice plasma protease | Fluorescence assay | Male CD1 mice plasma | In Vivo | None | None | N.A. | ||
| 28097629 | 2017 | PEG20k-TP508 | 23 | PEG20K | Amidation | Linear | L | TAMRA-labeled | Synthetic | Treatment of Diabetic Foot Ulcers | N.A. | 2.16 mM | 93 | Minutes | 5580 | Male CD1 mice plasma protease | Fluorescence assay | Male CD1 mice plasma | In Vivo | None | None | N.A. | ||
| 28097629 | 2017 | PEG30k-TP508 | 23 | PEG30K | Amidation | Linear | L | TAMRA-labeled | Synthetic | Treatment of Diabetic Foot Ulcers | N.A. | Molar equivalent of 1 mg/mL TP508 | 258 | Minutes | 15480 | Male CD1 mice plasma protease | Fluorescence assay | Male CD1 mice plasma | In Vivo | None | None | N.A. | ||
| 28065871 | 2017 | DOX-cRGD30-RCCMs | 5 | Free | RCCMs | Cyclic (RGDyK) | Mix | y = D-Tyr | Synthetic | Antitumor | -4 C for 10 h | 10 mg DOX equiv./kg | 4.7 (T1/2,b) | Hours | 16920 | Kunming mice retro-orbital sinus protease | Fluorescence assay | Kunming mice retro-orbital sinus | In Vivo | None | None | IC50 value for DOX-cRGD30-RCCMs is 1.9 µg/mL | ||
| 28065871 | 2017 | DOX-cRGD30-PEG-PCL | 5 | Free | PEG-PLC | Cyclic (RGDyK) | Mix | y = D-Tyr | Synthetic | Antitumor | -4 C for 10 h | 10 mg DOX equiv./kg | 1.2 (T1/2,b) | Hours | 4320 | Kunming mice retro-orbital sinus protease | Fluorescence assay | Kunming mice retro-orbital sinus | In Vivo | None | None | N.A. | ||
| 28005375 | 2017 | DOX-ATN/SCID-Ps | 5 | Acetylation | PEG-P(TMC-DTC) | Linear | Mix | None | Synthetic | Anticancer | N.A. | 150 μL | 4.13 (Elimination Half Life) | Hours | 14868 | Kunming mice retro-orbital sinus protease | Fluorescence assay | Kunming mice retro-orbital sinus blood | In Vivo | None | None | DOX-ATN56/SCID-Ps revealed a low IC50 of 5.2 μg/mL to B16F10 cells | ||
| 27990643 | 2017 | CN-105 | 5 | Acetylation | Amidation | Linear | L | None | APOE-derived peptide | Treatment of Spontaneous Intracranial Hemorrhage (Ich) | Blood samples were taken at 15 minutes prior to start of dosing and at 0.083, 0.167, 0.5, 1, 2, 4, 8, 12, and 24 hours from the start of dosing | 0.01 mg/kg | 2.3 ± 0.5 | Hours | 8280 | Human plasma protease | LC-MS/MS | Human plasma | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC5054364/ | None | N.A. | ||
| 27990643 | 2017 | CN-105 | 5 | Acetylation | Amidation | Linear | L | None | APOE-derived peptide | Treatment of Spontaneous Intracranial Hemorrhage (Ich) | Blood samples were taken at 15 minutes prior to start of dosing and at 0.083, 0.167, 0.5, 1, 2, 4, 8, 12, and 24 hours from the start of dosing | 0.03 mg/kg | 2.4 ± 0.5 | Hours | 8640 | Human plasma protease | LC-MS/MS | Human plasma | In Vivo | None | None | N.A. | ||
| 27990643 | 2017 | CN-105 | 5 | Acetylation | Amidation | Linear | L | None | APOE-derived peptide | Treatment Of Spontaneous Intracranial Hemorrhage (Ich) | Blood samples were taken at 15 minutes prior to start of dosing and at 0.083, 0.167, 0.5, 1, 2, 4, 8, 12, and 24 hours from the start of dosing | 0.1 mg/kg | 3.3 ± 0.6 | Hours | 11880 | Human plasma protease | LC-MS/MS | Human plasma | In Vivo | None | None | N.A. | ||
| 27990643 | 2017 | CN-105 | 5 | Acetylation | Amidation | Linear | L | None | APOE-derived peptide | Treatment Of Spontaneous Intracranial Hemorrhage (Ich) | Blood samples were taken at 15 minutes prior to start of dosing and at 0.083, 0.167, 0.5, 1, 2, 4, 8, 12, and 24 hours from the start of dosing | 0.3 mg/kg | 3.6 ± .4 | Hours | 12960 | Human plasma protease | LC-MS/MS | Human plasma | In Vivo | None | None | N.A. | ||
| 27990643 | 2017 | CN-105 | 5 | Acetylation | Amidation | Linear | L | None | APOE-derived peptide | Treatment Of Spontaneous Intracranial Hemorrhage (Ich) | Blood samples were taken at 15 minutes prior to start of dosing and at 0.083, 0.167, 0.5, 1, 2, 4, 8, 12, and 24 hours from the start of dosing | 1 mg/kg | 3.5 ± 0.3 | Hours | 12600 | Human plasma protease | LC-MS/MS | Human plasma | In Vivo | None | None | N.A. | ||
| 27881716 | 2017 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood collection at pre-dose and 0.25, 0.5, 1, 2, 4, 8 and 24 after dosing | 75 mg/kg | 3.81 | Hours | 13716 | Rats serum protease | LC-MS | Rats serum | In Vivo | None | None | EC50 (mg /dL) = 142.81 | ||
| 27881716 | 2017 | 22A | 22 | Free | Free | Linear | L | None | Synthetic | Treatment of Cardiovascular Diseases | Blood collection at pre-dose and 0.25, 0.5, 1, 2, 4, 8 and 24 after dosing | 75 mg/kg | 4.43 | Hours | 15948 | Rats serum protease | LC-MS | Rats serum | In Vivo | None | None | EC50 (mg /dL) = 142.81 | ||
| 27881716 | 2017 | 22A-sHDL | 22 | Free | sHDL | Linear | L | None | 22A and sHDL fusion protein | Antiatherosclerotic | Blood collection at pre-dose and 0.25, 0.5, 1, 2, 4, 8 and 24 after dosing | 75 mg/kg | 4.14 | Hours | 14904 | Rats serum protease | LC-MS | Rats serum | In Vivo | None | None | EC50 (mg /dL)= 47.63 | ||
| 27881716 | 2017 | 22A-sHDL | 22 | Free | sHDL | Linear | L | None | 22A and sHDL fusion protein | Antiatherosclerotic | Blood collection at pre-dose and 0.25, 0.5, 1, 2, 4, 8 and 24 after dosing | 150 mg/kg | 2.57 | Hours | 9252 | Rats serum protease | LC-MS | Rats serum | In Vivo | None | None | EC50 (mg /dL) = 53.77 | ||
| 27881716 | 2017 | 22A-sHDL | 22 | Free | sHDL | Linear | L | None | 22A and sHDL fusion protein | Antiatherosclerotic | Blood collection at pre-dose and 0.25, 0.5, 1, 2, 4, 8 and 24 after dosing | 150 mg/kg | 2.74 | Hours | 9864 | Rats serum protease | LC-MS | Rats serum | In Vivo | None | None | EC50 (mg /dL)= 47.63 | ||
| 27815337 | 2017 | P26 | 12 | Acetylation | Pro(4-Br)Phe substituition | Linear | Mix | Aib, DLeu,ProNle, D-Ala | Apelin analogs | Diuretic and Cardiovascular Effects | 37°C | 5 μM | 86 | Minutes | 5160 | Mouse plasma protease | LC-MS | Mouse plasma | In Vitro | None | None | Recruitment of b-arrestin2 by BRET, EC50 (nM) = 138 ± 30 | ||
| 27784692 | 2017 | KTP-ELP | 822 | Conjugation of KTP cyclic peptide at N terminal | Free | Linear | L | x = Val,Gly or Ala | Fusion protein of KTP and ELP | Carrier protein | Whole-animal fluorescence images were collected at regular intervals for 24 hours | 100 mg/kg | 234.83 (T1/2,Terminal) | Minutes | 14089.9 | Rats plasma protease | whole-body fluorescence imaging | Rats plasma | In Vivo | None | None | KTP-ELP, ELP, and SynB1-ELP show no toxicity in any of the renal cell lines tested, even at concentrations up to 40 μM for 72 hours | ||
| 27784692 | 2017 | ELP | 815 | Free | Free | Linear | L | x = Val,Gly or Ala | Synthetic | Carrier protein | Whole-animal fluorescence images were collected at regular intervals for 24 hours | 5 mg/kg | 90.3 (T1/2,Terminal) | Minutes | 5418 | Swine plasma protease | whole-body fluorescence imaging | Swine plasma | In Vivo | None | None | KTP-ELP, ELP, and SynB1-ELP show no toxicity in any of the renal cell lines tested, even at concentrations up to 40 μM for 72 hours | ||
| 27784692 | 2017 | KTP-ELP | 822 | Conjugation of KTP cyclic peptide at N terminal | Free | Linear | L | x = Val,Gly or Ala | Fusion protein of KTP and ELP | Carrier protein | Whole-animal fluorescence images were collected at regular intervals for 24 hours | 5 mg/kg | 118.6 (T1/2,Terminal) | Minutes | 7116 | Swine plasma protease | whole-body fluorescence imaging | Swine plasma | In Vivo | None | None | KTP-ELP, ELP, and SynB1-ELP show no toxicity in any of the renal cell lines tested, even at concentrations up to 40 μM for 72 hours | ||
| 27804918 | 2016 | APTEDB–SN38 | 26 | Free | Free | Cyclic (2 Trp-Trp Bond) | L | Ala-modified SN38 (Cys-Mal-PEG4-Ala-SN38) linked with Cys-modified APT EDB through Lys15 | Linker is Mal-PEG4 | Anticancer | At different times (0.08, 0.5, 1, 3, 6, 12 h) after injection | 1 mg/kg | 1.77 | Hours | 6372 | Mice plasma protease | HPLC | Mice plasma | In Vivo | https://sci-hub.st/10.1016/j.jconrel.2012.08.029 | None | IC50 = 472.6 nM | ||
| 27656777 | 2016 | VH434 | 8 | Acetylation | Amidation | Cyclic (C1-C8 Disulfide Bond) | L | None | VH445 analogues | Vectors targeting the LDL receptor | Incubated at 4°C or 37°C | 2 µM | 1.16 | Hours | 4176 | Mouse plasma protease | LC-MS/MS | (CD-1) mouse plasma | In Vitro | None | None | KD = 196 nM | ||
| 27656777 | 2016 | VH445 | 8 | Acetylation | Amidation | Cyclic (C1-C8 Disulfide Bond) | Mix | c = D-Cys at position 1 | VH445 | Vectors targeting the LDL receptor | Incubated at 4°C or 37°C | 2 µM | 3.03 | Hours | 10908 | Mouse plasma protease | LC-MS/MS | (CD-1) mouse plasma | In Vitro | None | None | KD = 76 nM | ||
| 27656777 | 2016 | VH4106 | 8 | Acetylation | Amidation | Cyclic | Mix | Pen, Thz = Penicillamine, Thiazolidine | VH445 analogues | Vectors targeting the LDL receptor | Incubated at 4°C or 37°C | 2 µM | 1.89 | Hours | 6804 | Mouse plasma protease | LC-MS/MS | (CD-1) mouse plasma | In Vitro | None | None | KD = 9 nM | ||
| 27656777 | 2016 | VH4127 | 8 | Pr = propionylation, c = D-Cys at N terminal | Amidation | Cyclic | Mix | Pen, Thz = non-natural amino acid | VH445 analogues | Vectors targeting the LDL receptor | Incubated at 4°C or 37°C | 2 µM | 4.27 | Hours | 15372 | Mouse plasma protease | LC-MS/MS | (CD-1) mouse plasma | In Vitro | None | None | KD = 18 nM | ||
| 27656777 | 2016 | VH4128 | 8 | Pr = propionylation, c = D-Cys at N terminal | Amidation | Cyclic | Mix | c = D-Cys and Pen, Thz, Sar = non-natural amino acid | VH445 analogues | Vectors targeting the LDL receptor | Incubated at 4°C or 37°C | 2 µM | 4.35 | Hours | 15660 | Mouse plasma protease | LC-MS/MS | (CD-1) mouse plasma | In Vitro | None | None | Introduction of the non-natural Sar residue at the Gly7 position had only minor impact on the affinity (compare VH4128 to VH4127 and VH4131 to VH4130 | ||
| 27656777 | 2016 | VH4130 | 8 | Pr = propionylation, c = D-Cys at N terminal | Amidation | Cyclic | Mix | c = D-Cys and Pen, Pip = non-natural amino acid | VH445 analogues | Vectors targeting the LDL receptor | Incubated at 4°C or 37°C | 2 µM | 4.03 | Hours | 14508 | Mouse plasma protease | LC-MS/MS | (CD-1) mouse plasma | In Vitro | None | None | Introduction of the non-natural Sar residue at the Gly7 position had only minor impact on the affinity (compare VH4128 to VH4127 and VH4131 to VH4130 | ||
| 27558296 | 2016 | Compound 31 | 13 | Palmitic acid conjugation | Free | Linear | L | Gly9 was exchanged with Lys, TAMRA = 5,6-carboxytetramethylrhodamine at Lys9 modification at Lysine , Nle= Nor-leucine at position 11, Aib = 2-Aminoisobutyric acid at position 12 | compound 31 analogues | Inotropic Agent | 37 C | 0.00001 M | ~4 | Hours | 14400 | Porcine liver homogenate protease | HPLC using a fluorescence detector | Porcine liver homogenate | In Vitro | None | None | EC50(nM) = 21.6 ± 4.5 for compound 31 | ||
| 27393654 | 2016 | IFN-α | 165 | Free | Free | Linear | L | None | Human derived | Antiproliferative, Immunoregulatory and Antiviral | At desired time points (1, 5, 15, 30 min, 1, 3, 6, 24,48, 72 and 96 h) | 1 mg IFN-α equivalent/kg | 1.49 (T1/2b-Terminal Half Life) | Hours | 5364 | Mice plasma protease | ELISA | Mice plasma | In Vivo | PDB id: 1ITF | None | IC50 = 10.77 pg/mL | ||
| 27243004 | 2016 | Api793 | 20 | Gu: N,N,N',N' tetramethylguanidino | Free | Linear | L | O = L-ornithine, (WO)2 repititive motifs substituited | Analogs of Api137 | Antimicrobial | After 0, 1, 2, 3, and 6 h aliquots (95 μL) were precipitated with aqueous TCA (25 μL, 15% w/v) | 70 mg/L | 246 | Minutes | 14760 | Mouse serum protease | N.A. | Mouse serum | In Vitro | None | None | IC50(g/L) = 0.64 ± 0.05 in HEK293 | ||
| 27243004 | 2016 | Api796 | 22 | Gu: N,N,N',N' tetramethylguanidino | Free | Linear | L | O = L-ornithine, (IO)3 repititive motifs substituited | Analogs of Api137 | Antimicrobial | After 0, 1, 2, 3, and 6 h aliquots (95 μL) were precipitated with aqueous TCA (25 μL, 15% w/v) | 70 mg/L | 249 | Minutes | 14940 | Mouse serum protease | N.A. | Mouse serum | In Vitro | None | None | IC50(g/l) > 0.6 in HEK293 | ||
| 27240277 | 2016 | ENF | 36 | Free | Free | Linear | L | None | Synthetic | Antiviral (against HIV infection) | N.A. | 1.7 μmol/kg | 1.5 ± 0.1 (Elimination Half Life) | Hours | 5400 | SD rats plasma protease | HPLC | SD rats plasma | In Vivo | None | None | EC50(nM) = 3 ± 0 | ||
| 27217590 | 2016 | PF1 | 9 | Free | Amidation | Cyclic (C1-C6 Disulfide Linkage) | L | Substitution of the Pro7 to Gly and Leu8 to a Lys appended with a polyethylene glycol space and a palmitoyl group, Palm = Palmitic acid | OT analog | Non–brain-penetrant OT receptor agonist | Time points postdose: 0.25 (OT only), 0.5, 1, 2, 4, 6, and 24 hours (6- and 24-hour sampling limited to PF1 only) | 4 ml/kg | 3.2 | Hours | 11520 | C57Bl/6J mice plasma protease | LC-MS/MS | C57BL/6J mice plasma | In Vivo | None | None | EC50(nM) = 0.025 (OTR agonist) | ||
| 27157666 | 2016 | cMBP2-PEG-Stp/NIS Polyplex | 12 | Free | PEG-Stp = succinoyl-tetraethylene pentamine/NIS gene | Linear | L | 123I labeling | Synthetic | Antitumor | 48 hours after polyplex administration, mice received an intraperitoneal injection of 18.5 MBq 123I | 18.5 MBq 123I | 3 | Hours | 10800 | Huh7 subcutaneous mice xenografts protease | Gamma counter | Huh7 subcutaneous mice xenografts | In Vivo | https://sci-hub.st/10.1016/j.nucmedbio.2009.01.005 | None | N.A. | ||
| 26982623 | 2016 | Peptide -5 (LTX-315) | 9 | Free | Amidation | Linear | L | Replacing Trp8 with the more bulky unnatural Dip = Diphenyalanine | Synthetic | Anticancer | 100 µl samples were taken after 0, 10, 20, 45 and 90 min | 1 µM | 71 | Minutes | 4260 | Cryopreserved rats hepatocyte protease | LC-MS/MS | Cryopreserved rats hepatocytes at a cell density of 0.5 million cells/ml | In Vitro | None | None | IC50 ± SD in µM = 34.3 ± 2.3 for MRC-5 cells | ||
| 26982623 | 2016 | Peptide -5 (LTX-315) | 9 | Free | Amidation | Linear | L | Replacing Trp8 with the more bulky unnatural Dip = Diphenyalanine | Synthetic | Anticancer | 100 µl samples were taken after 0, 10, 20, 45 and 90 min | 1 µM | 64 | Minutes | 3840 | Cryopreserved rats hepatocyte protease | LC-MS/MS | Cryopreserved rats hepatocytes at a cell density of 0.5 million cells/ml | In Vitro | None | None | IC50 ± SD in µM = 34.3 ± 2.3 for MRC-5 cells | ||
| 26869426 | 2016 | HsTX1[R14A] | 34 | Free | Amidation | Cyclic (C3-C24, C9-C29, C13-C31 Disulfide Linkage) | L | R14A substituitions | Isolated from the scorpion Heterometrus spinnifer | Treatment of Autoimmune Diseases | Blood samples (500 mL) were collected at 5, 15,30, 60, 120, 180, 240, and 300 min | 2 mg/kg | 79.6 ± 6.5 (Terminal elimination half life) | Minutes | 4776 | Rats plasma protease | LC-MS | Rats plasma | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/instance/2144240/pdf/10631983.pdf | None | IC50 value of 45 pM (affinity for Kv1.3 channels) | ||
| 26835125 | 2016 | IONP-HA-GEM-CTX-Cy5.5 | 36 | Conjugation of HA into CTX at N terminal in IONP-HA-GEM | Cy5.5 labeled | Linear | L | None | Synthetic | Glioblastoma therapy | At 1.5, 3, 6, 16, 24 and 48 h after injection, blood (20-50 L) was collected from tail veins | 2 mg/ml | ~2.8 | Hours | 10080 | BALB/c mice blood plasma protease | Fluorescence spectrometry | BALB/c mice blood plasma | In Vivo | PDB id: 1CHL | None | N.A. | ||
| 26806490 | 2016 | Wild-type IFN | 165 | Free | Free | Linear | L | None | Recombinant human IFN-α2b | Antiviral, Anticancer | N.A. | 1*106 U / 200 g | 1.4 ± 0.3 (Elimination Half Life) | Hours | 5040 | Wistar rats plasma protease | N.A. | Female Wistar rats plasma | In Vivo | PDB id: 1RH2 | None | Specific antiviral bioactivity (U ng−1) = 185 ± 30, Specific antiproliferative bioactivity (U ng−1) = 309 ± 65 | ||
| 26774588 | 2016 | PYY3-36 | 34 | Free | Amidation | Linear | L | None | Isolated and purified from porcine small intestine | Decrease appetite and food-intake | Conducted at 37ºC and aliquots were taken at 2, 5, 15, 30, 60, 120 and 240 min | 1 µM | 175 | Minutes | 10500 | Minipigs heparin-plasma protease | LC-MS | Minipigs heparin-plasma | In Vitro | None | None | N.A. | ||
| 26774588 | 2016 | PYY3-36 | 34 | Free | Amidation | Linear | L | None | Isolated and purified from porcine small intestine | Decrease appetite and food-intake | Conducted at 37ºC and aliquots were taken at 2, 5, 15, 30, 60, 120 and 240 min | 1 µM | 220 | Minutes | 13200 | Minipigs heparin-plasma protease | LC-MS | minipigs heparin-plasma with 10 mM EDTA | In Vitro | None | None | N.A. | ||
| 26754785 | 2016 | TfCuMT | 108 | Free | Free | Cyclic (4 Disulfide Bond Cys-Cys) | L | None | Copper metallothionein derived from ciliate Tetrahymena farahensis | Involved in metal homeostasis and metal detoxification by forming metal-thiolate complex | 37°C | N.A. | 103 | Minutes | 6180 | N.A. | SDS PAGE | Sonicated sample (20ml) +5 ml SDS loading buffer (50% glycerol, 10% SDS,0.5 M dithiothreitol, 0.25% bromophenol blue, 0.25 M Tris-Cl pH6.8) | In Vitro | None | None | N.A. | ||
| 26752086 | 2016 | ABB28 | 38 | 7 mer ABD domain conjugated at N terminus | Amidation | Linear | L | Biotinylation | Synthetic | Antitumor | N.A. | 30 nmol | 2 | Hours | 7200 | BALB/c mice plasma protease | ELISA | BALB/c mice plasma | In Vivo | None | None | IC50 ranges from 2.1–2.5 mM (In the absence of FBS) for ABB28 | ||
| 26725426 | 2016 | Exenatide | 39 | Free | Amidation | Linear | L | None | Exendin-4 analogs | Antihyperglycemic | N.A. | 23.88 nmol/mL | 3.53 | Hours | 12708 | Aminopeptidase N | Mass spectrometry | Intestinal fluid buffer (pH 6.8) with APN (0.2 U/mL) | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 26725426 | 2016 | Exenatide | 39 | Free | Amidation | Linear | L | None | Exendin-4 analogs | Antihyperglycemic | 37°C | 100 µg/mL | 1.718 | Hours | 6184.8 | Intestinal duodenum homogenate protease | Ultraviolet spectroscopy | Intestinal duodenum homogenate | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 26725426 | 2016 | Exenatide | 39 | Free | Amidation | Linear | L | None | Exendin-4 analogs | Antihyperglycemic | 37°C | 100 µg/mL | 1.462 | Hours | 5263.2 | Intestinal jejunum homogenate protease | Ultraviolet spectroscopy | Intestinal jejunum homogenate | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 26725426 | 2016 | Exenatide | 39 | Free | Amidation | Linear | L | None | Exendin-4 analogs | Antihyperglycemic | 37°C | 100 µg/mL | 1.229 | Hours | 4424.4 | Intestinal ileum homogenate protease | Ultraviolet spectroscopy | Intestinal ileum homogenate | In Vitro | PDB id: 7MLL | None | N.A. | ||
| 28989813 | 2016 | Exendin | 39 | Free | Amidation | Linear | L | Fluorescently labeled with Alexa Fluor | Derived from Heloderma suspectum | Antidiabetes | 10 μL of blood samples were collected from the tail vein into 100 μL of a heparin solution (1kU/ml in PBS, Sigma Aldrich) at 40 s, 40 min, 2.5 h, 4.5 h, 8 h, 24 h, 48 h, 72 h, 96 h and 120 h after injection | 75 nmol/kg | 1.7 ± 0.2 (T1/2 Elimination Half Life) | Hours | 6120 | Mice plasma protease | Fluorescence assay | Mice plasma | In Vivo | PDB id: 7MLL | None | EC50(nM) = 0.08 ± 0.01 | ||
| 26713839 | 2016 | MOD-4023 | 275 | CTP fused to hGH | 2 CTP fused | Linear | L | None | Synthetic | Treatment of GHD | Day 1 | 3.6 mg/kg | 3.12 | Hours | 11232 | Rats serum protease | Sandwich ELISA | Rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU | None | EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells) | ||
| 26713839 | 2016 | MOD-4023 | 275 | CTP fused to hGH | 2 CTP fused | Linear | L | None | Synthetic | Treatment of GHD | Day 1 | 3.6 mg/kg | 4.33 | Hours | 15588 | Rats serum protease | Sandwich ELISA | Rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU | None | EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells) | ||
| 26713839 | 2016 | MOD-4023 | 275 | CTP fused to hGH | 2 CTP fused | Linear | L | None | Synthetic | Treatment of GHD | Day 1 | 36 mg/kg | 3.69 | Hours | 13284 | Rats serum protease | Sandwich ELISA | Rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU | None | EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells) | ||
| 26713839 | 2016 | MOD-4023 | 275 | CTP fused to hGH | 2 CTP fused | Linear | L | None | Synthetic | Treatment of GHD | Day 1 | 180 mg/kg | 4.79 | Hours | 17244 | Rats serum protease | Sandwich ELISA | Rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU | None | EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells) | ||
| 26713839 | 2016 | MOD-4023 | 275 | CTP fused to hGH | 2 CTP fused | Linear | L | None | Synthetic | Treatment of GHD | Day 26 | 36 mg/kg | 3.71 | Hours | 13356 | Rats serum protease | Sandwich ELISA | Rats serum | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU | None | EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells) | ||
| 26574515 | 2016 | CII-a | 40 | Free | Free | Linear | L | Two amphipathic helices linked by proline19 | Synthetic | Treatment of Hypertriglyceridemia | 0, 0.5, 1, 4, 7, 24, and 48 hours | 1.0μmol/kg of body weight | 1.33 ± 0.72 | Hours | 4788 | Apoc2 Mutant Mice Plasma Protease | MALDI-TOF MS | Apoc2 mutant mice plasma | In Vivo | https://pmc.ncbi.nlm.nih.gov/articles/PMC4293430/ | None | peptide C-II-a dose of 5 μmol/kg achieved a maximum decrease of approximately 90% after 30 minutes, with plasma TG remaining below baseline levels for up to 48 hours | ||
| 26574515 | 2016 | CII-a | 40 | Free | Free | Linear | L | Two amphipathic helices linked by proline19 | Synthetic | Treatment of Hypertriglyceridemia | 0, 0.5, 1, 4, 7, 24, and 48 hours | 1.0 μmol/kg of body weight | 1.33 ± 0.72 | Hours | 4788 | Apoc2 mutant mice plasma protease | MALDI-TOF MS | Apoc2 mutant mice plasma | In Vivo | None | None | peptide C-II-a dose of 5 μmol/kg achieved a maximum decrease of approximately 90% after 30 minutes, with plasma TG remaining below baseline levels for up to 48 hours | ||
| 26565554 | 2016 | NG29-TFacetate | 10 | SarLys = N-methyl glycine and Lysine | TFacetate = Trifluoroacetate addition at C terminal | Linear | Mix | D-Phenyalanine substituitions for L-Phenylanine and Arg9 removal from C terminal | BK analogue | Role in Neurological and Ischemic Cardiovascular diseases and brain cancer | N.A. | 75 mg/kg | 2.28 (Elimination Half Life) | Hours | 8208 | Wistar Han rats plasma protease | LC-MS/MS | Wistar Han rats plasma | In Vivo | https://sci-hub.st/10.1139/y02-053 | None | IC50(nM) = 0.3 for SarLys[dPhe8]desArg9BK ( for hB1R ) | ||
| 26565554 | 2016 | NG29-acetate | 10 | SarLys = N-methyl glycine and Lysine | Acetate addition at C terminal | Linear | Mix | (f) D-Phenyalanine substituitions for L-Phenylanine (F) and Arg9 removal from C terminal | BK analogue | Role in Neurological and Ischemic Cardiovascular diseases and brain cancer | N.A. | 75 mg/kg | 2.38 (Elimination Half Life) | Hours | 8568 | Wistar Han rats plasma protease | LC-MS/MS | Wistar Han rats plasma | In Vivo | None | None | IC50(nM) = 0.3 for SarLys[dPhe8]desArg9BK ( for hB1R ) |