Peplife 2.0 - Basic Search Results

Browsing by half-Life: Between 36001 to 54000 Seconds

Browse Results:

Filter by Year
From
Upto

ID	PMID	YEAR	Sequence	Name	Length	N-ter MOD	C-ter MOD	Linear/Cyclic	Chirality	Chem-MOD	Origin	Nature	Incubation Time	Concentration	Half Life	Protease	Assay	Test Sample	Vivo/Vitro	Reference	Patent No.	Activity
1069	15012592	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	N-acetyl-GLP-1	30	Acetylation	Free	Linear	L	None	Glucagon	Antihyperglycaemic, insulinotropic	Not reported	2mM peptide incubated with 1.25 mU of DPP IV	>12	DPP IV	LC/MS equipped with a microbore C-18 HPLC	DPP IV	in vitro	None	None	Insulinotropic activity in vitro at 5 ·6 mM glucose
1070	15012592	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	N-pyroglutamyl-GLP-1	30	PyroGlutamic acid at 1st position	Free	Linear	L	None	Glucagon	Antihyperglycaemic, insulinotropic	Not reported	2mM peptide incubated with 1.25 mU of DPP IV	>12	DPP IV	LC/MS equipped with a microbore C-18 HPLC	DPP IV	in vitro	None	None	Insulinotropic activity in vitro at 5 ·6 mM glucose
1072	15012592	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	N-acetyl-GLP-1	30	Acetylation	Free	Linear	L	None	Glucagon	Antihyperglycaemic, insulinotropic	Not reported	2mM peptide incubated with 7.5 µl of human plasma	>12	Human plasma proteases	LC/MS equipped with a microbore C-18 HPLC	Human plasma	in vitro	None	None	Insulinotropic activity in vitro at 5 ·6 mM glucose
1073	15012592	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	N-pyroglutamyl-GLP-1	30	PyroGlutamic acid at 1st position	Free	Linear	L	None	Glucagon	Antihyperglycaemic, insulinotropic	Not reported	2mM peptide incubated with 7.5 µl of human plasma	>12	Human plasma proteases	LC/MS equipped with a microbore C-18 HPLC	Human plasma	in vitro	None	None	Insulinotropic activity in vitro at 5 ·6 mM glucose
1082	11099487	2000	RQIKIWFQNRRMKWKKNELKRAFAALRDQI	Int-H1-S6A,F8A	30	Free	Free	Linear	L	None	C-Myc derivative	Antiproliferative and proapoptotic	Not reported	Not mentioned	11.95	Fetal calf serum proteases	HPLC	Fetal bovine serum batch1	in vitro	None	None	Not reported
1107	15246869	2004	H-Abu-EGTFTSDVSSYLEGQAAKEFIAWLVKGR	(Abu8)GLP-1	30	Free	Free	Linear	L	2-aminobutyric acid (Abu)	Synthetic	Potentiate postprandial insulin secretion and glucose clearance	12 hours	2mM	>12	Human plasma protease	Radioimmunoassay	Human plasma	in vitro	None	None	cAMP EC50=4.7 ±1.3nM
1110	15246869	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	GLP-1	30	Free	Free	Linear	L	None	Glucagon-like peptide-1(7-36)amide	Potentiate postprandial insulin secretion and glucose clearance	12 hours	2mM	>12	Human plasma proteases except DPP	Radioimmunoassay	Human plasma+DPA (DPA is DPP inhibitor)	in vitro	None	None	cAMP EC50=6.1 ±1.8nM
1111	15246869	2004	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	GIP	42	Free	Free	Linear	L	None	Gastrointestinal incretin hormone	Potentiate postprandial insulin secretion and glucose clearance	12 hours	2mM	>12	Human plasma proteases except DPP	Radioimmunoassay	Human plasma+DPA (DPA is DPP inhibitor)	in vitro	8446620	None	cAMP EC50=21.8 ±1.5nM
1178	14759771	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	N-acetyl-GLP-1	30	Acetylation	Amidation	Linear	L	None	Derivative of glucagon-like peptide-1	Regulate blood glucose	12 hours	2 mM	>12	Purified DPP IV	ESI-MS	Purified DPP IV	in vitro	None	None	12 ±0.4% insulin intensity in ARIP cells
1180	14759771	2004	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	N-acetyl-GLP-1	30	Acetylation	Amidation	Linear	L	None	Derivative of glucagon-like peptide-1	Regulate blood glucose	12 hours	2 mM	>12	Serum proteases	ESI-MS	Serum	in vitro	None	None	16 ±0.1% glucokinase intensity in ARIP cells
1214	21114599	2010	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	hGLP-1(7-36)NH2	30	Free	Amidation	Linear	L	None	Glucagon like peptide-1	Regulate blood glucose	Not mentioned	Not mentioned	10.3	Human plasma proteases	HPLC	Human plasma	in vitro	14759771	None	EC50=0.08 ±0.03nM for cAMP stimulation
1215	21114599	2010	H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVKGR	[Aib8]hGLP-1(7-36)NH2	30	Free	Amidation	Linear	L	Aib--Aminoisobutyric acid	Analogue of glucagon like peptide-1	Regulate blood glucose	Not mentioned	Not mentioned	12.1	Human plasma proteases	HPLC	Human plasma	in vitro	14759771	None	EC50=0.29 ±0.22nM for cAMP stimulation
1831	17640899	2007	TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAILREL	T-267225	38	Free	Free	Linear	L	None	Synthetic peptide	Antiviral peptide	Not reported	~1 €“2mg/kg	12.4	Monkey blood proteases	RP-HPLC and ESI-MS	Male cynomolgus monkey blood plasma (Intravenous)	in vivo	None	None	IC50=0.019 µg/ml against IIIB virus
1832	17640899	2007	TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAILREL	T-267225	38	Free	Free	Linear	L	None	Synthetic peptide	Antiviral peptide	Not reported	~1 €“2mg/kg	12.4	Monkey blood proteases	RP-HPLC and ESI-MS	Male cynomolgus monkey blood plasma (Intravenous)	in vivo	None	None	IC50=0.043 µg/ml against 098 virus
1833	17640899	2007	TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAILREL	T-267225	38	Free	Free	Linear	L	None	Synthetic peptide	Antiviral peptide	Not reported	~1 €“2mg/kg	12.4	Monkey blood proteases	RP-HPLC and ESI-MS	Male cynomolgus monkey blood plasma (Intravenous)	in vivo	None	None	IC50=0.079 µg/ml against 098-T20 virus virus
1834	17640899	2007	TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAILREL	T-267225	38	Free	Free	Linear	L	None	Synthetic peptide	Antiviral peptide	Not reported	~1 €“2mg/kg	12.4	Monkey blood proteases	RP-HPLC and ESI-MS	Male cynomolgus monkey blood plasma (Intravenous)	in vivo	None	None	IC50=0.038 µg/ml against 098-T1249 virus
1835	17640899	2007	TTWEAWDRAIAEYAARIEALIRALQEQQEKNEAILREL	T-267225	38	Free	Free	Linear	L	None	Synthetic peptide	Antiviral peptide	Not reported	~1 €“2mg/kg	12.4	Monkey blood proteases	RP-HPLC and ESI-MS	Male cynomolgus monkey blood plasma (Intravenous)	in vivo	None	None	IC50=0.196 µg/ml against 098-T651 virus
2008	15587934	2004	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH	AlbuBNP	32	Human serum albumin	Free	Linear	L	None	B-type cardiac natriuretic peptides fused to HAS at N-terminal	Vasodilator	Not reported	2.19 mg/kg	11.2	Mouse blood proteases	EIA	Mice plasma (Intravenous injection)	in vivo	None	None	EC50 =28.4 ± 1.2 nM
2051	19533722	2009	NPVENMMDRDSQ	C6	12	Free	Free	Linear	L	None	Synthetic peptide	Mimic putative inhibitor epitopes (mimotopes),	Not reported	150 µM	~12	Human plasma proteases	ELISA	Human plasma	in vitro	None	None	IC50 =30 €“50 µM
2087	N.A.	2004	ELAGIGILTV	[NMeEI, amide]-Melan-A	10	Free	Amidation	Linear	L	Methylation of nitrogen of amide bond b/w Glu1 and Leu2 (NMe)	Melan peptide which binds to HLA	Immunogenic and HLA binding peptides	N.A.	25 nM	12	Human serum proteases	HPLC-ESI-MS	Serum (human)	in vitro	None	EP1395276A1	EC50= 1 nM
2088	N.A.	2004	pGlu-LAGIGILTV	[pEI, amide]-Melan-A	10	PyroGlutamic acid at 1st position	Amidation	Linear	L	Pyroglutamic acid	Melan peptide which binds to HLA	Immunogenic and HLA binding peptides	N.A.	25 nM	11	Human serum proteases	HPLC-ESI-MS	Serum (human)	in vitro	None	EP1395276A1	EC50= 0.3 nM
2090	N.A.	2004	ALAGIGILTV	[Î²Al, amide] -Melan-A	10	Beta-Alanine1	Amidation	Linear	L	None	Melan peptide which binds to HLA	Immunogenic and HLA binding peptides	N.A.	25 nM	11	Human serum proteases	HPLC-ESI-MS	Serum (human)	in vitro	None	EP1395276A1	EC50= 0.03 nM
2094	N.A.	2004	DLAGIGILTV	[Î²Dl, amide] -Melan-A	10	Beta-Asp1	Amidation	Linear	L	None	Melan peptide which binds to HLA	Immunogenic and HLA binding peptides	N.A.	25 nM	12	Human serum proteases	HPLC-ESI-MS	Serum (human)	in vitro	None	EP1395276A1	EC50= 10 nM
2096	N.A.	2004	GLAGIGILTV	[NOHG1, amide]-Melan-A	10	Hydroxylation of N-terminal of Glycine	Amidation	Linear	L	None	Melan peptide which binds to HLA	Immunogenic and HLA binding peptides	N.A.	25 nM	13	Human serum proteases	HPLC-ESI-MS	Serum (human)	in vitro	None	EP1395276A1	EC50= 0.04 nM
2099	N.A.	2004	ELAGIGILTV	[Î±MeL2, V10-amide]-Melan-A	10	Free	Amidation	Linear	L	Methylation of carboxyl of Leu2	Melan peptide which binds to HLA	Immunogenic and HLA binding peptides	N.A.	25 nM	12	Human serum proteases	HPLC-ESI-MS	Serum (human)	in vitro	None	EP1395276A1	EC50= isomer1(2.5 nM); isomer2(0.1 nM)
2442	7522585	1994	rPKPfQwFwLLRPKPQQFFGLM	Antagonist D [D-Arg1,D-Phe5,D-Trp7,9,Leu11]-SP	22	Free	Free	Linear	Mix	None	Substance P (SP) analogue	Anticancer drugs	1, 2, 5 and 24 hours	0.1 Î¼g/ml	11.8	SCLC proteases	RP-HPLC and Electrochemical Detection	Small cell lung cancer (SCLC)	in vitro	None	None	Act as growth factors
2447	7522585	1994	RwFWLMRPKPQQFFGLM	Antagonist G [Arg6, D-Trp7,9, MePhe8] - substance P (6-11)	17	Free	Free	Linear	Mix	Methylation of phenylalanine at 3rd position	Substance P (SP) analogue	Anticancer drugs	1, 2, 5 and 24 hours	0.1 Î¼g/ml	14.6	Mouse liver proteases	RP-HPLC and Electrochemical Detection	Mouse liver homogenate	in vitro	None	None	Act as growth factors
2497	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	31	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	1.25 Î¼g/kg	14	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2498	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	32	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	2.5 Î¼g/kg	11	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2500	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	34	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	5.0 Î¼g/kg	15	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2501	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	35	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	10 Î¼g/kg	14	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2502	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	36	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	12.5 Î¼g/kg	12	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2503	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	37	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	15 Î¼g/kg	13	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2504	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	38	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	17.5 Î¼g/kg	11	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2505	12145241	2002	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG	NN2211 (Glucagon- Like Peptide 1 Derivative)	39	Free	Free	Linear	L	Î³-Glu-palmitoyl residue at position 21	Glucagon-like peptide 1 (GLP-1) derivative	Anti-diabetic peptide	48 hours	20 Î¼g/kg	11	Dipeptidyl peptidase IV (DPP-IV), human blood proteases	Not mentioned	Subcutaneously injected in Humans	in vivo	https://www.bachem.com/api-products/generic-apis/l	None	Significant increase in insulin secretion (P = 0.0002), but there was no significant effect on glucagon levels.
2510	19805567	2010	CYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF	Enfuvirtide-PEG12-CP	37	Acetylation	Free	Linear	L	Mal-PEG12-CP was conjugated to Cys-enfuvirtide	Enfuvirtide conjugate	Antiretroviral fusion inhibitor	5, 15, and 30 min and 1, 2, 4, 8, 24, and 48 h after drug injection	dose, 4 mg/kg of body weight	10.4	Wistar rats blood protease	LC-MS/MS	Female Wistar rats	in vivo	None	None	The enfuvirtide-CP conjugates displayed similar EC50s that ranged from 51 nM to 72 nM
2522	17682073	2007	NQEEVSPYTLLKG	NC100668	13	Acetylation	Tc chelator (NC100194)	Linear	L	Tyr residue at 8 position is Iodionated	Cell penetrating peptides-Phosphorodiamidate morpholino oligomers	Tracer tested for nuclear medical imaging	1, 1.5, 3, 6, 12, and 24 hours	20, 100, 500, 1000, and 2000 Î¼g	10.5 (terminal elimination)	Human plasma proteases	LC-MS	Injected in human plasma	in vivo	None	None	Not reported
2571	8218482	1993	YRGDS	RGD containing peptide	5	Free	Free	Linear	L	I125 radiolabeling, covalently attached to an isocyanate-containing poly urethane prepolymer	Extra Cellular Matrix proteins	Antitumor peptide	Not mentioned	0.2 mL	11.3 (t1/2 second phase)	Mice blood proteases	Radioimmunoassay	Intravenously injected to C57BL6 mice	in vivo	None	None	Less effective in in blocking peptide-mediated attachment of B16-FlO melanoma cells to a surface.
2602	16982323	2006	(GGLYACHMGPITX1AVCQPLRX2)2Beta-ala-PEG	Hematide	42	Acetylation	Beta-alanine-PEG	Linear	L	X1-Napthyl-alanine, X2-Sarcosine	Synthetic dimeric peptide	Erythropoiesis stimulating agent	Not mentioned	0.02 mg/kg	14.6 ±4.3	Monkey plasma proteases	Competitive ELISA	Monkey plasma (Dose i/v adminstered)	in vivo	None	None	IC50 = 37pM for HuEPOr/125I-EPO competition binding assay, EC50 =460 pM for cell proliferation stimulation
2691	25039358	2014	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	Coumarin-modified GLP-1 derivative 6	30	Free	Amidation	Linear	L	X-1 = Cys- conjugated-7-hydroxyCoumarin maleimide	Analog of human GLP-1	Hypoglycaemic	37 °C for 2-72 hours	1000ng/ml	15	Rat plasma proteases	LC-MS/MS	Rat Plasma	in vitro	None	None	GLP-1 receptor Activation potency with EC50 = 18.1 ± 0.9 pM in HEK-293 cells
2693	25039358	2014	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	Coumarin-modified GLP-1 derivative 8	30	Free	Amidation	Linear	L	X-1 = Cys- conjugated-7-hydroxyCoumarin maleimide	Analog of human GLP-1	Hypoglycaemic	37 °C for 2-72 hours	1000ng/ml	12.9	Rat plasma proteases	LC-MS/MS	Rat Plasma	in vitro	None	None	GLP-1 receptor Activation potency with EC50 = 7.1 ± 0.9 pM in HEK-293 cells
2695	25039358	2014	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR	Coumarin-modified GLP-1 derivative 10	30	Free	Amidation	Linear	L	X-1 = Lys- conjugated-7-hydroxyCoumarin maleimide	Analog of human GLP-1	Hypoglycaemic	37 °C for 2-72 hours	1000ng/ml	11.8	Rat plasma proteases	LC-MS/MS	Rat Plasma	in vitro	None	None	GLP-1 receptor Activation potency with EC50 =12.1 ± 0.5 pM in HEK-293 cells
2700	25039358	2014	HAEGTFTSDVSSYLEGQAAK(Î³-Glu-palmitoyl)EFIAWLVRGRG	Liraglutide	31	Free	Free	Linear	L	Î³-Glu-palmitoyl at 21 st position	Analog of human GLP-1	GLP-1 receptor agonist	37 °C for 2-72 hours	1000ng/ml	14 .9 ±0.9	Rat plasma proteases	LC-MS/MS	Rat Plasma	in vivo	None	None	GLP-1 receptor Activation potency with EC50 =9.5 ± 0.8 pM in HEK-293 cells
2710	25894376	2015	PlLQAtLGGGS	P32 (Fibroblast growth factor 2- binding peptide derivative)	11	Free	Amidation	Linear	Mix	None	Fibroblast growth factor 2- binding peptide derivative	Anti-proliferative	37 °C for 1-48hours	0.3478Î¼M	12	Human plasma proteases	HPLC	Human plasma	in vitro	None	None	P32 significantly inhibited the proliferation of SGC-7901, MGC-803, and KATOIII cells induced with 20ng/ml of FGF2, and the IC50 values of P32 were 0.77, 1.69, and 1.09 Î¼mol/L, respectively
2721	25771000	2015	MWQRPSSWIEGRFPHSDAVFTDQYTRLRKQLAAKKYLQSLKQKRY	MHDBAY (Recombinant PACAP-derived peptide)	45	Free	Free	Linear	L	None	Synthetic (Pituitary adenylate cyclase-activating peptides (PACAPs) derived peptide)	Insulin secretion stimulant	0.5-24 hours	0.5 mg/kg	12.19	db/db mice plasma proteases	LC-MS/MS	(Dose i/v injected)Mice plasma	in vivo	None	None	AUC for glucose -stimulated 1st phase insulin secretion in MHDBAY-treated mice (20nmol/kg) is 2.26 fold higher than control
2722	25771000	2015	MWQRPSSWIEGRFPHSDAVFTDQYTRLRKQLAAKKYLQSLKQKRY	MHDBAY (Recombinant PACAP-derived peptide)	45	Free	Free	Linear	L	None	Synthetic (Pituitary adenylate cyclase-activating peptides (PACAPs) derived peptide)	Insulin secretion stimulant	0.5-24 hours	0.5 mg/kg	>12	Rabbit plasma proteases	LC-MS/MS	New Zealand White Rabbit plasma (Dose i/v injected)	in vivo	None	None	AUC for glucose -stimulated 1st phase insulin secretion in MHDBAY-treated mice (20nmol/kg) is 2.26 fold higher than control
2732	26197931	2015	YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	Porcine-PYY(1-36)	36	Free	Free	Linear	L	None	Synthetic peptide hormone released from enteroendocrine cells	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	37 °C for 24 hours	Not mentioned	10.8 ±0.8	Pig blood proteases	Radioimmunoassay and HPLC	Female pigs blood + Peptide sample+ DPP-IV inhibitor (valine pyrrolidide) + aprotinin	in vitro	None	None	Human PYY 3 €“36 signaled through the Y-2 receptor in COS-7 cells with potency with EC50 = 3.5nmol/L
2734	26197931	2015	YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	Porcine-PYY(1-36)	36	Free	Free	Linear	L	None	Synthetic peptide hormone released from enteroendocrine cells	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	37 °C for 24 hours	Not mentioned	11.9 ±0.7	Pig plasma proteases	Radioimmunoassay and HPLC	Female pigs plasma+ Peptide sample+ DPP-IV inhibitor (valine pyrrolidide) + aprotinin	in vitro	None	None	Human PYY 3 €“36 signaled through the Y-2 receptor in COS-7 cells with potency with EC50 = 3.5nmol/L
2737	26222180	2015	HA/EGTFTSDVSSYLEGQAAKEFIAWLVKGR	G36A or [GLP-1(7-36A)]	30	Free	Amidation	Linear	L	None	Glucagon-like peptide 1 (GLP-1)	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	Room Temp	0.4 µM	13 ±0.7	Human plasma proteases + DPP IV	MS	Human Plasma+ Heparin	in vitro	None	None	Not reported
2742	26222180	2015	HA/EGTFTSDVSSYLEGQAAKEFIAWLVKGR	G36A or [GLP-1(7-36A)]	30	Free	Amidation	Linear	L	None	Glucagon-like peptide 1 (GLP-1)	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	Room Temp	0.4 µM	Apr-24	Human plasma proteases + DPP IV	MS, ELISA	EDTA plasma	in vitro	None	None	Not reported
2743	26222180	2015	HA/EGTFTSDVSSYLEGQAAKEFIAWLVKGR	G36A or [GLP-1(7-36A)]	30	Free	Amidation	Linear	L	None	Glucagon-like peptide 1 (GLP-1)	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	On ice	0.4 µM	12 ±3	Human plasma proteases + DPP IV	MS, ELISA	EDTA plasma	in vitro	None	None	Not reported
2748	26222180	2015	HA/EGTFTSDVSSYLEGQAAKEFIAWLVKGRG	G 37 or [GLP-1(7 €“37)]	31	Free	Free	Linear	L	None	Glucagon-like peptide 1 (GLP-1)	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	Room Temp	0.4 µM	04 to 18	Human plasma proteases + DPP IV	MS, ELISA	EDTA plasma	in vitro	None	None	Not reported
2753	26222180	2015	HA/EGTFTSDVSSYLEGQAAKEFIAWLVKGRG	G 37 or [GLP-1(7 €“37)]	31	Free	Free	Linear	L	None	Glucagon-like peptide 1 (GLP-1)	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	Room Temp	0.4 µM	12 ±1.0	Human blood proteases + DPP IV	MS	P800 whole blood	in vitro	None	None	Not reported
2755	26222180	2015	YA/EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	GIP (1-42) (Glucosedependent insulinotropic polypeptide)	42	Free	Free	Linear	L	None	Proprotein of gastrointestinal tract	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	Room Temp	0.4 µM	May-20	Human plasma proteases + DPP IV	MS	EDTA plasma	in vitro	None	None	Not reported
2756	26222180	2015	YA/EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ	GIP (1-42) (Glucosedependent insulinotropic polypeptide)	42	Free	Free	Linear	L	None	Proprotein of gastrointestinal tract	Antihyperglycemic or incretin effect(Stimulate Insulin release in glucose dependent manner)	Room Temp	0.4 µM	May-20	Human serum proteases + DPP IV	MS	Serum	in vitro	None	None	Not reported
2760	26222180	2015	HS/QGTFTSDYSKYLDSRRAQDFVQWLMNT	Glucagon	29	Free	Free	Linear	L	None	Peptide hormone of pancrease	Regulates hypoglycemia	Room Temp	0.4 µM	May-20	Human plasma proteases + DPP IV	MS	EDTA plasma	in vitro	None	None	Not reported
2765	26308095	2015	HAEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG	Liraglutide	31	Free	Free	Linear	L	Acylation of peptide at K-26 with C-18(palmitic acid) fatty di-acid chain	Glucagon-like peptide 1 (GLP-1) analogue	Upregulates intracellular cAMP resulting in the release of insulin	Blood sample collected after 1-96 hours after the injection of peptide	5nmol/Kg	14.4 hours	Rat plasma proteases	ELISA, LC/MS	Rat Plasma (Dose i/v injected)	in vivo	None	None	Not reported
2772	26337231	2015	MWQRPSSWIEGRLLTHTISRIAVSYQTKVNLL	RMP-16 (Recombinant slow-release TNF Î±-derived peptide)	32	Free	Free	Linear	L	None	Recombinant slow-release TNF Î±-derived peptide	Tumor growth inhibitor and anti-angiogenic	Blood sample collected after0.5-24 hours after the injection of peptide	5mg/kg	13.11 ±1.49	BALB/c mice plasma proteases	LC/MS	BALB/c mice plasma (Dose i/v injected)	in vivo	None	None	Growth inhibition effect of RMP16 was observed in DU145 cells (IC50 = 17.20 ± 1.95 nM, the tumor inhibition rates of RMP16-treated mice was 78.11%
2783	25625650	2015	HAEGTFTSDVSSYLEGQAAK(Î³-Glu-palmitoyl)EFIAWLVRGRG	Liraglutide	31	Free	Free	Linear	L	Î³-Glu-palmitoyl at 21 st position	Analog of human GLP-1	GLP-1 receptor agonist	0.25-84 hours	0.6mg s/c injected	12 ±2.8	Cat blood proteases	ELISA	Healthy cat blood (Dose s/c injected)	in vivo	None	None	Insulin secretion increased 760.8 ± 350.7 (449 €“1,493) ng/L on Liraglutide administration as compared to normal 455.5 ±115.8 (411 €“660) in hyperglycemic patients
2796	24139844	2013	HSSKLQ	Conjuagte 2(conjugates of 4-aminocyclophosphamide (4-NH2-CPA))	6	Succinylation	Amidated CPA	Linear	L	None	Synthetic peptide derived from conjugates of 4-aminocyclophosphamide (4-NH2-CPA)	Anti-cancer	Not mentioned	Not mentioned	12	PSA(Prostate-specific antigen )	HPLC	Conjuagte 2+PSA(Prostate-specific antigen)	in vitro	None	None	pEC50-8.59 ±0.9minutes, Emax 9.30 ±0.26nmol/well
2814	5092290	2014	[LL-37, 37 aa]	LL-37 (Antimicrobial Peptide)	37	Free	Free	Linear	L	None	Human epithelial cells(proteolytic cleavage of c-ter portion of hCAP-18 protein)	Antimicrobial	15-720 minutes hour	3 µM	>12	Cathepsin	Proteolysis assay, (confirmed by Western blotting)	Western Blotting	in vitro	16716248	None	Not reported
2821	1329046	1992	Pyr-QRLGNQWAVGHLL	[Psi13,14]BN [Bombesin antagonist]	14	Free	Amidation	Linear	L	Pyr=Pyro-glutamine	Bombesin analogue	Growth inhibitors	0-1080 minutes	50Î¼M	646	Degradative enzymes or SCLC cell line proteases	RP-HPLC	SCLC cell line NCI-H345	in vitro	None	None	IC50= 30nM, Peptide were added at a 1 Î¼M dose to inhibit growth of SCLC cell line
2971	2556215	1989	DRVYIHPFHL	Angiotensin I (AI)	10	Free	Free	Linear	L	None	Derived from angiotensin	Precusor of angiotensin- II (AII)	37 °C	100 - 2000 ng/ml	12.6	Fetal calf serum proteases	Radioimmunoassay	Primary endothelial cells + Fetal calf Serum (5%) + heat inactvation	in vitro	None	None	Not mentioned
2989	8217216	1993	SDKP	AcSDKP (Acetyl-SDKP)	4	Acetylation	Free	Linear	L	None	Isolated from fetal calf bone marrow	Natural hemoregulatory	37 °C for 24 hours	4 X lO-7M, 10 µCi	11.5	Proteases from Heat inactivated calf serum	HPLC	Heat inactivated calf serum + 1Î¼M catropril	in vitro	None	None	Not reported
2994	8218482	1993	YRGDS	YRGDS-polymer conj µgate(Isocyanate containing polyurethane prepolymer)	5	Free	Free	Linear	L	Peptide covalently attached to Isocyanate containing polyurethane prepolymer	Synthetic RGD containing peptide	Cell attachment property	Not mentioned	Not mentioned	11.3(Half life of 2nd phase)	Proteases from mouse bood	HPLC	Mouse blood	in vivo	None	None	Not reported
3121	21210710	2011	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR	Linear chlorotoxin(CTX)	36	Free	Free	Linear	L	N-hydroxysuccinimide ester(NHS-ester)modified Cy5.5 at Lysine 15,23 and 27	Scorpion venom	Identify tumor foci with high sensitivity	24 hours	50Î¼l of 40Î¼M	14	Mice serum proteases	Imaging system to measure fluorescent intensity	Intravenous injection in two month old wild-type C57BL/6 mice	in vivo	http://www.drugbank.ca/drugs/DB00140	None	Fluorescent efficiency (cm2) in the tumor compared with control mice=2.49 ±1
3122	21210710	2011	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCRGAGAAGG	Cyclic chlorotoxin(CTX)	43	Free	Free	Cyclic (C2-C19, C5-C28, C16-C33, C20-C35)	L	N-hydroxysuccinimide ester(NHS-ester)modified Cy5.5 at Lysine 15,23 and 28	Analog of CTX	Identify tumor foci with high sensitivity	24 hours	50Î¼l of 40Î¼M	11	Mice serum proteases	Imaging system to measure fluorescent intensity	Intravenous injection in two month old wild-type C57BL/6 mice	in vivo	http://www.drugbank.ca/drugs/DB00141	None	Fluorescent efficiency (cm2) in the tumor compared with control mice=3.3 ±1.81
4009	38789061	2024	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG	Liraglutide (Lymph cannulated)	31	Free	Free	Linear	L	Lys-30 is replaced by Arg and Lys-20 is acylated with a C16 palmitic acid linkd with γGlu	GLP-1 analogs	Antidiabetes	Lymph was collected continuously into tubes at specified time intervals: predose, 0–15 min, 15–30 min, 30 45 min, 45–60 min, 1–1.5 hr, 1.5–2 hr, 2–3 hr, 3–4 hr, 4–6 hr, 6–8 hr, 8–10 hr, 10–24 hr, and 24–30 hr	2 mg/kg	12.61 ± 5.45	Male SD rats lymph protease	UHPLC	Male SD rats thoraic lymph	In Vivo	None	None	N.A.
4010	38789061	2024	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Exenatide (Lymph cannulated)	39	Free	Amidation	Linear	L	None	Exendin-4 analogs	Antidiabetes	Lymph was collected continuously into tubes at specified time intervals: predose, 0–15 min, 15–30 min, 30 45 min, 45–60 min, 1–1.5 hr, 1.5–2 hr, 2–3 hr, 3–4 hr, 4–6 hr, 6–8 hr, 8–10 hr, 10–24 hr, and 24–30 hr	1 mg/kg	10.26 ± 6.51	Male SD rats lymph protease	UHPLC	Male SD rats thoraic lymph	In Vivo	PDB id: 7MLL	None	N.A.
4055	38340726	2024	IEEQAKTFLDKFNHEAEDLFYQSSLGGSKGDFRGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQ	A1L35HR2m-Chol	114	Conjugation of angiotensin-converting enzyme 2 (ACE2)-derived peptide A1 to the N terminus of the viral HR2-derived peptide HR2m through a long flexible linker,	Chol conjugation at C terminal	Linear	L	None	fusion protein of A1 and HR2m	Antiviral (Inhibits Coronaviruses)	N.A.	5 mg/kg	10.6	Balb/c mice serum protease	N.A.	Balb/c mice trachea tissue homogenate	In Vivo	None	None	A1L35HR2m was highly potent in inhibiting SARS-CoV-2 infection with an IC50 value of 27 nM
4058	38293540	2024	ENLYFQHGEGTFTSDVSSYLEGQAAKEFIAWLVKGRGGGGSGGGGSGGGGSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGGGGSGGGGSGGGGSHSQGTFTSDYSKYLDSRRAQDFVQWLMNTGGEGGSEGSEGEGSEGSGEGEGGSEGSEGEGSEGSGEGEGGSEGSEGEGGSEGSEGEGGEGSGEGEGSEGSGEGEGSGEGSEGEGGSEGGEGEGSEGGSEGEGSEGGSEGEGGEGSGEGEGGGEGSEGEGSEGSGEGEGSGEGSEG	GLP-ABD-XTEN144	257	GLP-1 molecule was linked to the N-terminus of ABD via a (GGGGS)3 linker (GLP-ABD), His-tag	ABD was connected to the N-terminus of the XTEN polypeptide (144 amino acids) through a (GGGGS)3 linker	Linear	L	None	Fusion protein of GLP-1, ABD, XTEN (either 144 or 288)	Antidiabetes, Antiobesity	At 1, 3, 7, 12, 18, 24, 30, 36 h, approximately 30 μL of blood was drawn from the tail vein	5 nmol	12.9	C57Bl/6 mice plasma protease And DPP-4	ELISA	C57BL/6 mice plasma	In Vivo	None	None	GLP-ABD-XTEN144 has a Kd value of only 5.50 nM
4060	38236561	2024	HQGTFTSDKSEYLDSERARDFVAWLEAGG	Cotadutide	29	Free	Free	Linear	L	palm-Glu-OH conjugated at Lys9 side chain	Synthetic	Dual GLP-1 and Glucagon (GCG) Receptor agonist	N.A.	20 to 600 μg	13.3	N.A.	N.A.	N.A.	In Vivo	None	None	N.A.
4186	37449781	2023	pSar200-b-pCys(SO2Et)30	NCL30	230	Polysarcosine = poly(N-methyl glycine)	Free	Linear	L	fluorescently labeled with Atto647N, polysarcosine-block-poly(S-ethylsulfonyl-l-cysteine)	synthetic	Improve the therapeutic profile of hydrophobic drugs, reduce or completely avoid protein corona formation	Blood samples of 50 μL were collected from the tail vein at the defined time points after systemic administration: 10 min, 1 h, 6 h, 24 h, 72 h	5 μg/μL	11.4	C57BL/6 mice plasma protease	Fluorescence spectrophotometry	C57BL/6 mice plasma	In Vivo	None	None	Not mentioned
4187	37449781	2023	pSar200-b-pCys(SO2Et)30	2F-CL30	230	Polysarcosine = poly(N-methyl glycine)	Free	Linear	L	fluorescently labeled with Atto647N, polysarcosine-block-poly(S-ethylsulfonyl-l-cysteine)	synthetic	Improve the therapeutic profile of hydrophobic drugs, reduce or completely avoid protein corona formation	Blood samples of 50 μL were collected from the tail vein at the defined time points after systemic administration: 10 min, 1 h, 6 h, 24 h, 72 h	5 μg/μL	11.3	C57BL/6 mice plasma protease	Fluorescence spectrophotometry	C57BL/6 mice plasma	In Vivo	None	None	Not mentioned
4262	36631971	2023	LVPRVDKPPYLPRPRPPROIYNO	20k-prodrug	23	Onc72 N-terminally coupled via a short peptide linker LVPR to 20 kDa thiol PEGs	Amidation, Orn at position 23	Linear	L	Orn at postion 19	Synthetic	Antimicrobial	0, 4, 8, 16, and 24 h aliquots (47.5 μL) were taken in triplicates	31.5 μmol/L	14	Mouse serum protease	Serum stability assay	Mouse serum	In Vivo	None	None	20 kDa thiol-PEG: Reduced cell viability more significantly, to ≈70% for both cell lines
4268	36630826	2023	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Ex-PEGRh(4.4 ± 1.1nm)	39	Free	PEGylation (Rh(4.4 ± 1.1nm)) and linked via DBCO	Linear	L	Fluorescently labeled	Exendin-4 analogs	Antidiabetes	Blood collection at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h	1000 nmol kg−1	11.9 ± 2.7 (T1/2 Elimination)	Immunized mice plasma protease	Fluorescence assay	Immunized mice plasma	In Vivo	None	None	EC50 = 1.3 ± 0.2 nM
4269	36630826	2023	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Ex-POEGMAopt(54.7KDa)	39	Free	POEGMA (poly[oligo(ethylene glycol) methyl ether methacrylate]) conjugation (MW opt = 54.7KDa)	Linear	L	Fluorescently labeled	Exendin-4 analogs	Antidiabetes	Blood collection at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h	1000 nmol kg−1	12.1 ± 1.0 (T1/2 Elimination)	Immunized mice plasma protease	Fluorescence assay	Immunized mice plasma	In Vivo	None	None	EC50 = 2.8 ± 0.7 nM
4280	36630826	2023	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Ex-PEGRh	39	Fluorescently labelled	Exendin-DBCO was conjugated to azide-functional PEG(27.7KDa)	Linear	L	None	Exendin-4 analogs	Antidiabetes	Ten μl of blood was collected from a tiny incision on the tail vein into tubes containing 90 μl of 1,000 U ml-1 heparin (Sigma) at 5-min, 1-, 2-, 4-, 8-, 24-, 48-, 72-, 96-, 120-, 144- and 168-h.	1000 nmol/kg	11.9 ± 2.7 (T1/2 Elimination)	Immunized mice plasma protease	fluorescence assay	Immunized mice plasma	In Vivo	None	None	EC50 (nM) = 1.3 ± 0.2
4287	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KEEIHQ-Aib-EFIEWLLAQGPSSGAPPPS	SEQ ID NO 19	39	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post S.C. application	0.5 mg/kg	10.3	Mice plasma protease	LC-MS	Mice plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 2.0
4290	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KDRIHQ-Aib-EFIEWLLAQRG	SEQ ID NO 6	31	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.08, 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post I.V. application	0.25 mg/kg	11.2	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.5
4292	N.A.	2023	Y-Aib-EGT-Iva-ISDLSI-Aib-KDRIHQ-Aib-EFIEWLLAQRG	SEQ ID NO 16	31	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid, Iva = Isovaline	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.08, 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post I.V. application	0.25 mg/kg	11.5	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.1
4293	N.A.	2023	Y-Aib-EGT-Iva-ISDLSI-Aib-KDRIHQ-Aib-EFIEWLLAQRG	SEQ ID NO 16	31	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid, Iva = Isovaline	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post S.C. application	0.5 mg/kg	10.8	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.1
4296	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KERIHQ-Aib-EFIEWLLAQGPSSGAPPPS	SEQ ID NO 21	39	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.08, 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post I.V. application	0.25 mg/kg	12.9	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.8
4297	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KERIHQ-Aib-EFIEWLLAQGPSSGAPPPS	SEQ ID NO 21	39	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post S.C. application	0.5 mg/kg	12.1	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.8
4298	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KDR-Aib-HQ-Aib-EFIEWLLAQRPSSGAPPPS	SEQ ID NO 22	39	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.08, 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post I.V. application	0.25 mg/kg	13.6	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 1
4300	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KDRIHQEEFIQWLLAQGPSSGAPPPS	SEQ ID NO 35	39	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.08, 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post I.V. application	0.25 mg/kg	14.5	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.6
4301	N.A.	2023	Y-Aib-EGTFISDLSI-Aib-KDRIHQEEFIQWLLAQGPSSGAPPPS	SEQ ID NO 35	39	Free	Amidation	Linear	L	Aib = α-aminoisobutyric acid	Exendin-4 analogs	Antidiabetes	Blood samples were collected after 0.25, 0.5, 1 , 2, 4, 8, 24, 32, and 48 H post S.C. application	0.5 mg/kg	14.3	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	EP 2022074607 W	IC50 hGIPR (nM) = 0.6
4315	N.A.	2023	PXXFLSPYHSRVSSRKESKKPPAKLSPRK	SEQ ID NO 31	29	Free	Free	Linear	L	X = Octanoyl-Dpr at position 3, NMeS = N- methyl-L-serine at position 2	Human Ghrelin Analog	Ghrelin Receptor Agonist	Solutions were incubated at 37 C for 60, 120 and 180 Minutes	1 mg/ml	12	Plasma protease	LC-MS	Diluted plasma	In Vitro	None	EP 2023054305 W	EC50(nM) = 50.3
4468	36380917	2022	HAEGTFTSNVSSYLEGQAAKEFIAWLVKGRG	Glycan-GLP-1-1(G2S2)	31	Free	Free	Linear	L	N-glycosylation with sialylated biantennary complex-type N-glycan at Asn15 (G2S2 glycoform = sialylated glycan)	GLP-1 analogs	Antidiabetes	37 °C	6 nmol	736.6 ± 12.3	Mouse serum protease	RP-HPLC	Mouse serum	In Vitro	None	None	BGLmax (mmol L−1) = 28.71 ± 2.63 (In vivo glucose stabilizing capability)
4470	36380917	2022	HAEGTFTSDVSSYLEGQAANESIAWLVKGRG	Glycan-GLP-1-3(G2)	31	Free	Free	Linear	L	N-glycosylation with biantennary complex-type N-glycan at Asn26 (G2 glycoform = glycan)	GLP-1 analogs	Antidiabetes	37 °C	6 nmol	738.6 ± 9.7	Mouse serum protease	RP-HPLC	Mouse serum	In Vitro	None	None	BGLmax (mmol L−1) = 24.07 ± 3.79 (In vivo glucose stabilizing capability)
4476	36380917	2022	HAEGTFTSDVSSYLEGQAAKEFIAWLVNGTG	Glycan-GLP-1-5(G2S2)	31	Free	Free	Linear	L	N-glycosylation with sialylated biantennary complex-type N-glycan at Asn34 (G2S2 glycoform = sialylated glycan)	GLP-1 analogs	Antidiabetes	37 °C	6 nmol	777.0 ± 10.2	Mouse serum protease	RP-HPLC	Mouse serum	In Vitro	None	None	BGLmax (mmol L−1) = 15.50 ± 3.74 (In vivo glucose stabilizing capability)
4486	36323988	2022	HADGSFSDEMNTILDNLAARDFINWLIQTKITD	Glepaglutide	33	Free	Free	Linear	L	None	GLP-2 analogue	Treatment of Short Bowel Syndrome	Blood sampling for a pharmacokineticanalysis in these subjects was conducted pre-dose and at 5,10, 15, 20, 25, 35, 45, 60, 75 and 90 min and 2, 3, 4, 8, 12,16, 20, 24, 36 and 48 h after the start of the IV infusion, and again on day 22	1 mg	10.4	Human plasma protease	LC-MS	Human plasma	In Vivo	None	None	EC50 = 0.12 nM In vitro potency
4487	36323988	2022	HGEGTFSSELATILDALAARDFIAWLIATKITDKKKKKK	Glepaglutide parent	39	Free	Six lysines has been added at C terminal , Amidation	Linear	L	None	GLP-2 analogue	Treatment of Short Bowel Syndrome	Blood sampling for a pharmacokineticanalysis in these subjects was conducted pre-dose and at 5,10, 15, 20, 25, 35, 45, 60, 75 and 90 min and 2, 3, 4, 8, 12,16, 20, 24, 36 and 48 h after the start of the IV infusion, and again on day 22	1 mg	11.7	Human plasma protease	LC-MS	Human plasma	In Vivo	None	None	EC50 = 0.12 nM In vitro potency
4494	36142749	2022	Dmt-kFFKKPFTL	PK20	10	Replacing tyrosine (Tyr) with 2,6-dimethyltyrosine (Dmt) at position 1	Free	Linear	Mix	D-amino acid residue (D-Lys) inserted at position 2	opioid–neurotensin hybrid peptide	Analgesic	37°C for 24 h	50 μg/mL	11.36	N.A.	LC-MS	1M NaOH	In Vitro	None	None	EC50 = 79 nM (potency at mu opioid receptor)
4520	36075899	2022	N.A.	S-20-1	N.A.	N.A.	N.A.	Cyclic	L	Modified by adding negative charge	Synthetic	Antiviral (Against Infection By Sars-Cov-2 )	Blood samples were collected at 10 min, 20 min, 30 min, 1 h, 2 h, 4 h, 8 h, 24 h and 48 h	50 mg/kg	14.53 (Terminal Elimination Half Life)	C57Bl/6 mice plasma protease	LC-MS/MS	C57BL/6 mice plasma	In Vivo	None	None	IC50 (μM) = 0.8 in HUH 7 cells
4527	35990007	2022	desH-AEGTFTSDVSSYLEEQAAREFIAWLVRGRKX	Peptides 1	31	desH indicates the non-natural amino acid deamino-histidine	Free	Linear	L	X = R1, R2 = H (R2 group present in R1)	GLP-1R agonist	Antidiabetes, Antiobesity	200 µL blood samples were taken at 2, 6, 10, 24, 30 and 48 h	20 nmol/kg	10.9	Rats plasma protease	UPLC-MS	Rats plasma	In Vivo	None	None	N.A.
4528	35990007	2022	desH-AEGTFTSDVSSYLEEQAAREFIAWLVRGRKX	Peptides 1	31	desH indicates the non-natural amino acid deamino-histidine	Free	Linear	L	X = R1, R2 = H (R2 group present in R1)	GLP-1R agonist	Antidiabetes, Antiobesity	200 µL blood samples were taken at 2, 6, 10, 24, 30 and 48 h	18059 pmol/kg	12.2	Rats plasma protease	UPLC-MS	Rats plasma	In Vivo	None	None	N.A.
4529	35990007	2022	desH-AEGTFTSDVSSYLEEQAAREFIAWLVRGRKX	Peptides 1	31	desH indicates the non-natural amino acid deamino-histidine	Free	Linear	L	X = R1, R2 = H (R2 group present in R1)	GLP-1R agonist	Antidiabetes, Antiobesity	200 µL blood samples were taken at 2, 6, 10, 24, 30 and 48 h	18058 pmol/kg	10.7	Rats plasma protease	UPLC-MS	Rats plasma	In Vivo	None	None	N.A.
4531	35990007	2022	desH-AEGTFTSDVSSYLEEQAAREFIAWLVRGRKX	Peptides 1	31	desH indicates the non-natural amino acid deamino-histidine	Free	Linear	L	X = R1, R2 = H (R2 group present in R1)	GLP-1R agonist	Antidiabetes, Antiobesity	200 µL blood samples were taken at 2, 6, 10, 24, 30 and 48 h	18052 pmol/kg	12.9	Rats plasma protease	UPLC-MS	Rats plasma	In Vivo	None	None	N.A.
4544	35892256	2022	GIVEQCCTSICSLYQLENYCN/FVNQHLCGSHLVEALYLVCGERGFFYTPKT	RA15127343	51	Free	Free	Linear	L	Albumin binding fatty-acid side chain is coupled to lysine (B29)	Insulin analogue	Antidiabetes	N.A.	200 nmol/kg	11	Rats plasma protease	LC-MS/MS	Rats plasma	In Vivo	https://sci-hub.st/10.1016/j.jpba.2018.07.009	None	(Activity values of RA15127343) IC50 for IR-A: 19.9 μM, IC50 for IR-B: 6.31 μM, EC50 for IR-A: 2.054 μM, EC50 for IR-B: 669.6 nM
4593	35688476	2022	DNPSLSIDLTFHLLRTLLELEKQEKEKQQACQNRIIFDSV	PEG-hUCN1	40	Free	Amidation	Linear	L	Insertion of a cysteine residue at position 31 for pegylation PEG20 acetamide	Human UCN1 derivative	Treating Autoimmune disease	N.A.	0.3 mg/kg	13	C57Bl/6J mice plasma protease	Laser capture/mass spectrometry	C57BL/6J mice plasma	In Vivo	None	None	At the CRHR1 receptor, the PEG-hUCN1 peptide was less potent than native CRH or UCN1 peptides with EC50 values of 47, 15, and 10 nM, respectively
4596	35677307	2022	MTPLGPASSLPQSFLLKCLEQVRKIQADGAALLANQVRQVGDGAALQEKLVSELGNALENALPDTLDTLQLDVKDYFSLRAALLAALPTRLRYLQEADAFQRRAGGVLVASHLGTSLQRLALADSGVLRQLLYYIESGPHQAPLGTGGADQGAMNVTCSKELQAYREQILHDCWLPKDLKDLQLLIEMNVTVLVDIDKLVEVLRLRQGVLHGVHVC	PEG10k-rhG-CSF	175	Free	Free	Linear	L	PEG10K-MAL fatty chain-modification of rhG-CSF at Cys18 position	rhG-CSF derivative	N.A.	sampling time - 0, 0.5, 2, 4, 8, 12, 24, 48, 72, 96, 120, 144, 168h	1.0 mg/kg	13.05 ± 0.45	Mice Serum Protease	ELISA	Mice serum	In Vivo	None	None	N.A.
4614	35582852	2022	lKlW	CP	8	Free	PNAM37 linked through NH2 group	Cyclic(N-C terminal bond)	Mix	D-leucine at position 1 and 3	Synthetic	Drug delivery vectors	Blood samples (0.2 mL) were taken prior to dose administration and at 1, 5, 10, 20, 30, 60, 120, 180, 240, 360, 480, and 1440 min after dose administratio	1 μCi	14.6 ± 2.9 (Elimination Half Life)	Rats plasma protease	Liquid scintillation counter	Rats plasma	In Vivo	None	None	For concentrations of 1 mg/mL CP , cell viabilities drop to about 75% for the 4T1 cell line
4634	35414877	2022	MCFTHFHMLWPFCGSGSDYKDDDDK	B_1275.1	25	C18 diacid-gGlu-2xOEG	Amidation, FLAG tag	Cyclic	L	None	Synthetic	Targets GIP receptor	N.A.	2 μM	643(Elimination Half Life)	Rats plasma protease	LC-MS	Rats plasma	In Vivo	None	None	IC50(nM) = 1209
4682	34807760	2022	RRWVRRVRRVWRRVVRVVRRWVRR	PLG0206	24	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Blood samples for PK assessment were collected at predose, at the midpoint of infusion, within 1 min of the end of infusion, and at 0.5, 1, 2, 4, 6, 8, 12, 20, 24, 36, and 48 h after the end of infusion	0.125 mg/kg	10.5 (Median Terminal Half Life)	Human plasma protease	HPLC-MS	Human plasma	In Vivo	Pubchem CID : 16152467	None	N.A.
4684	34807760	2022	RRWVRRVRRVWRRVVRVVRRWVRR	PLG0206	24	Free	Free	Linear	L	None	Synthetic	Antimicrobial	Blood samples for PK assessment were collected at predose, at the midpoint of infusion, within 1 min of the end of infusion, and at 0.5, 1, 2, 4, 6, 8, 12, 20, 24, 36, and 48 h after the end of infusion	0.25 mg/kg	13.16 (Median Terminal Half Life)	Human plasma protease	HPLC-MS	Human plasma	In Vivo	Pubchem CID : 16152467	None	N.A.
4782	35177945	2022	QRPRLSHKGPMPA	(Ala13)apelin-13	13	Free	Ala13 modifcation, carboxylation	Linear	L	None	Apelin-13 Analogue	Insulinotrophic activity	0, 2, 4, 8, 24 h	20 μg	10.3	Mouse plasma protease	RP-HPLC	Mouse plasma in the presence of 50 Mmol/L TEA-HCl Buffer	In Vitro	https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/	None	EC50(M) = 1.74e-009 (In vitro insulin secretion)
4784	35177945	2022	pGlu-RPRLSHKGPMPA	pGlu(Ala13)apelin-13	13	pGlu = Pyroglutamate	Ala13 modifcation, carboxylation	Linear	L	None	Apelin-13 Analogue	Insulinotrophic activity	0, 2, 4, 8, 24 h	20 μg	11.1	Mouse plasma protease	RP-HPLC	Mouse plasma in the presence of 50 Mmol/L TEA-HCl Buffer	In Vitro	https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/	None	EC50(M) = 7.68e-009 (In vitro insulin secretion)
4786	35177945	2022	pGlu-RPRLSHKGPMPY	pGlu(Tyr13)apelin-13	13	pGlu = Pyroglutamate	Tyr13 modifcation, carboxylation	Linear	L	None	Apelin-13 Analogue	Insulinotrophic Activity	0, 2, 4, 8, 24 h	20 microgram	12.2	Mouse plasma protease	RP-HPLC	Mouse plasma in the presence of 50 Mmol/L TEA-HCl Buffer	In Vitro	https://pubmed.ncbi.nlm.nih.gov/29412822/, https://pubmed.ncbi.nlm.nih.gov/27815337/	None	EC50(M) = 1.48e-008 (In vitro insulin secretion)
4798	35259149	2022	(CH-Mal-C6-GIVEQCCTSICSLYQLENYCN)-(FVNQHLCGSHLVEALYLVCGERGFFYTPK-C6-Mal-CH)	CH-/HPN-Conjugated Insulins (GlyA1/LysB29)	50	Gly1(A) Maleimide modified linked using linker C6 (N-[ε-maleimidocaproyloxy] sulfosuccinimide ester, EMCS) with chondroitin [CH]	K29(B) Maleimide modified linked using linker C6 (N-[ε-maleimidocaproyloxy] sulfosuccinimide ester, EMCS) with chondroitin [CH]	Cyclic (C6-C11 disulfide bond in A chain)	L	C7-C7 and C20-C19 disulfide bond between A and B chain	Human insulin analog	Antidiabetes	Blood samples were collected immediately before injection and at various time points up to 48 h after injection	340 nmol/kg	11.8	Mice serum protease	Sandwich ELISA	Mice serum	In Vivo	https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/	None	EC50(nM) = 32.87
4803	35259149	2022	(CH-Mal-C11-GIVEQCCTSICSLYQLENYCN)-(FVNQHLCGSHLVEALYLVCGERGFFYTPK-C11-Mal-CH)	CH-/HPN-Conjugated Insulins (GlyA1/LysB29)	50	Gly1(A) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH]	K29(B) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH]	Cyclic (C6-C11 disulfide bond in A chain)	L	C7-C7 and C20-C19 disulfide bond between A and B chain	Human insulin analog	Antidiabetes	Blood samples were collected immediately before injection and at various time points up to 48 h after injection	340 nmol/kg	14	Mice serum protease	Sandwich ELISA	Mice serum	In Vivo	https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/	None	EC50(nM) = 86.25
4804	35259149	2022	(CH-Mal-C11-GIVEQCCTSICSLYQLENYCN)-(FVNQHLCGSHLVEALYLVCGERGFFYTPK-C11-Mal-CH)	CH-/HPN-Conjugated Insulins (GlyA1/LysB29)	50	Gly1(A) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH]	K29(B) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with chondroitin [CH]	Cyclic (C6-C11 disulfide bond in A chain)	L	C7-C7 and C20-C19 disulfide bond between A and B chain	Human insulin analog	Antidiabetes	Blood samples were collected immediately before injection and at various time points up to 48 h after injection	340 nmol/kg	12.1	Mice serum protease	Sandwich ELISA	Mice serum	In Vivo	https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/	None	EC50(nM) = 86.25
4810	35259149	2022	(HPN-Mal-C11-GIVEQCCTSICSLYQLENYCN)-(FVNQHLCGSHLVEALYLVCGERGFFYTPK-C11-Mal-HPN)	CH-/HPN-Conjugated Insulins (GlyA1/LysB29)	50	Gly1(A) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) withheparosan [HPN]	K29(B) Maleimide modified linked using linker C11 (N-[κ-maleimidoundecanoyloxy]- sulfosuccinimide ester, KMUS) with heparosan [HPN]	Cyclic (C6-C11 disulfide bond in A chain)	L	C7-C7 and C20-C19 disulfide bond between A and B chain	Human insulin analog	Antidiabetes	Blood samples were collected immediately before injection and at various time points up to 48 h after injection	100 nmol/kg	12.9	Mice serum protease	Sandwich ELISA	Mice serum	In Vivo	https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/	None	EC50(nM) = 88.23
4814	35259149	2022	(HPN-Mal-C3-GIVEQCCTSICSLYQLENYCN)-FVNQHLCGSHLVEALYLVCGERGFFYTPK	CH-/HPN-Conjugated Insulins (GlyA1)	50	Gly1(A) Maleimide modified linked using linker C3 (N-[β-maleimidopropyloxy] succinimide ester, BMPS) with heparosan [HPN]	Free	Cyclic (C6-C11 disulfide bond in A chain)	L	C7-C7 and C20-C19 disulfide bond between A and B chain	Human insulin analog	Antidiabetes	Blood samples were collected immediately before injection and at various time points up to 48 h after injection	100 nmol/kg	11.7	Mice serum protease	Sandwich ELISA	Mice serum	In Vivo	https://pubs.acs.org/doi/10.1021/acsomega.9b00059, https://pubmed.ncbi.nlm.nih.gov/28365509/	None	EC50(nM) = 6.54
4834	35807558	2022	IKPEAPGEDASPEELNRYYASLRHYLNLVTR-MeArg-Y	[MeArg35]PYY3−36	34	Free	Methylated Arg35 at C terminus	Linear	L	None	PYY analogue	Antidiabetes, Antiobesity	The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min)	1 μM	620	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vitro	https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/	None	Ki(nM) = 500 (In Vitro Binding of Peptide Analogues against Human Y1 receptor)
4835	35807558	2022	IKPEAPGEDASPEELNRYYASLRHYLNLVTR-MeGln-RY	[MeGln34]PYY3−36	34	Free	Methylated Gln34 at C terminus	Linear	L	Methylated Gln34	PYY analogue	Antidiabetes, Antiobesity	The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min)	1 μM	890	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vitro	https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/	None	Ki(nM) = 0.40 (In Vitro Binding of Peptide Analogues against Human Y1 receptor)
4838	35807558	2022	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQ-βArg-Y	[β-homoArg35]PYY3−36	34	Free	β-homoArg35 at C terminus	Linear	L	None	PYY analogue	Antidiabetes, Antiobesity	The reaction was stopped at selected time points (5, 15, 30, 60, 90, 120, 150, 180, 210, 240, 270, and 300 min)	1 μM	680	Minipigs plasma protease	LC-MS	Minipigs plasma	In Vitro	https://pubmed.ncbi.nlm.nih.gov/34647404/, https://pubmed.ncbi.nlm.nih.gov/30399314/	None	Ki(nM) = 6300 (In Vitro Binding of Peptide Analogues against Human Y1 receptor)
4858	34707178	2021	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	PYY3-36 analogues 2	34	Free	Amidation	Linear	L	Fatty acid conjugation at position 4 (C18 diacid-γGlu-2xAdo)	Derived from PYY	Antiobesity	Blood samples (0.8 ml) were taken either from the jugular vein using vacutainer or from the IV catheter not used for dosing according to one of the following schedules: Predose, and 5, 15, 30, 45 min, 1 h, 1.5 h, 2 h, 3 h, 4 h, 6 h, 8 h, 10 h, 24 h, 48 h, 72 h,96 h, 120 h, 168 h, 192 h, 216 h, 240 h, 264 h and 288 h post dosing; or Predose, and 5, 30 min, 1 h, 2 h, 4 h, 7 h, 11 h, 24 h, 48 h, 72 h,96 h, 120 h, 168 h, 216 h, 264 h post dosing	15 nmol/kg	14	Male göttingen minipigs plasma protease	LC-MS	Male göttingen minipigs plasma	In Vivo	None	None	EC50(nM) = 10 for Y2 receptor
4860	34707178	2021	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	PYY3-36 analogues 7	34	Free	Amidation	Linear	L	Fatty acid conjugation at position 9	Derived from PYY	Antiobesity	N.A.	15 nmol/kg	12	Male göttingen minipigs plasma protease	LC-MS	Male göttingen minipigs plasma	In Vivo	None	None	EC50(nM) = 40 for Y2 receptor
4862	34707178	2021	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	PYY3-36 analogues 9	34	Free	Amidation	Linear	L	Fatty acid conjugation at position 11	Derived from PYY	Antiobesity	N.A.	15 nmol/kg	11	Male göttingen minipigs plasma protease	LC-MS	Male göttingen minipigs plasma	In Vivo	None	None	EC50(nM) = 1.3 for Y2 receptor
4863	34707178	2021	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	PYY3-36 analogues 11	34	Free	Amidation	Linear	L	Fatty acid conjugation at position 13	Derived from PYY	Antiobesity	N.A.	15 nmol/kg	13	Male göttingen minipigs plasma protease	LC-MS	Male göttingen minipigs plasma	In Vivo	None	None	EC50(nM) = 16 for Y2 receptor
4875	34707178	2021	IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY	PYY3-36 analogues 39	34	Free	Amidation	Linear	L	Fatty acid conjugation at position 30	Derived from PYY	Antiobesity	N.A.	15 nmol/kg	13	Male göttingen minipigs plasma protease	LC-MS	Male göttingen minipigs plasma	In Vivo	None	None	N.A.
4886	34707178	2021	IKPEAPGEDASPEELNRYYASLRHYLNRKVTRQRY	PYY3-36 analogues 50	35	Free	Amidation	Linear	L	Fatty acid conjugation at position 30, Acetylation at Asn28	Derived from PYY	Antiobesity	N.A.	15 nmol/kg	120	Male göttingen minipigs plasma protease	LC-MS	Male göttingen minipigs plasma	In Vivo	None	None	N.A.
4920	34163352	2021	NMP-YKEIEQLIELANYQV	NOPT	16	OPT substituted with an N-methyl proline at position 1	Free	Linear	L	None	Derived from OPT	Binds To Pser68-Plm	Aliquots of 50 μl were collected at different time points (0–48 h)	300 μM	14.9	Human serum protease	Mass spectrometry	Human serum	In Vitro	None	None	N.A.
4934	33940058	2021	gqsehhmrvysf	OPBP-1@TMC	12	Free	Free	Linear	D	Substituition of A with Y at position 10	Derived from H12	Anticancer	Co-incubation of OPBP-1 with 10% human serum for 0 h, 1 h, 2 h, 4 h, 8 h, 16 h, 24 h, 32 h and 48 h.	20 mg/kg	14.55 ± 1.43	Male SD rats plasma protease	RP-HPLC	Male SD rats plasma	In Vivo	None	None	After 2 weeks of daily administration of 0.5 mg/kg OPBP-1, the tumor growth was significantly inhibited in CT26 and B16-OVA models.
4936	33918853	2021	TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG-GGGSGGGTGGGSGGG-GFLG-ASPAAPAPAPAAPAPSAPAASPAAPAPASPAAPAPSAPA-GGSGG	HFn-PAS/DOX	235	Free	15aa linker, enzyme cleavable site, PAS(40), 5 aa flexible linker conjugated at C terminus	Linear	L	None	Synthetic	Antitumor	Blood samples were collected from the retro orbital sinus at fixed time points (10, 30 min, 1, 2, 4, 8, 12, 24, 36, 48 h) at 37 °C	3.0 mg/kg	14.96 ± 0.29	SD rats serum protease	Fluorescence spectrometry	SD rats serum	In Vivo	PDB id: 3AJO	None	IC50 (μg mL−1) = 0.38 ± 0.09
5038	32078672	2020	KTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLYDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG	rFVIIIFc	865	Free	IgG1 Fc	Linear	L	None	Synthetic	Role In Clotting	N.A.	200 IU/kg	13.2	VWF Het mice plasma protease	chromogenic activity assays	VWF Het mice plasma	In Vivo	PDB id : 5K8D, https://pmc.ncbi.nlm.nih.gov/articles/instance/7180082/bin/bloodBLD2019001292-suppl1.pdf	None	ED50 values for BIVV001 (7.5 IU/kg) and rFVIII (7.9 IU/kg) were similar
5095	32858124	2020	C13-γGlu-OEG-OEG-hArg-rQ-hArg-Pr-NMeLeu-SHKG-Oic-pIPhe-P-DBip	Cmpd# 10	16	Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C13	Free	Linear	Mix	hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid	Derived from pyr-apelin-13	Treatment of Chronic Hepatic Failure	N.A.	0.5 mg/kg	10.2	Male SD rats plasma protease	Scintillation proximity assay	Male SD rats plasma	In Vivo	None	None	Rat GTPγS (nM) EC50 ± SE = 6.22 ± 1.6
5097	32858124	2020	C17-γGlu-OEG-OEG-hArg-rQ-hArg-Pr-NMeLeu-SHKG-Oic-pIPhe-P-DBip	Cmpd# 14	16	Acetylation, N-terminus of apelin-13 linked via, liphophilic moiety pIPhe polypeptide spacer (-γGlu-OEG-OEG-) with C17	Free	Linear	Mix	hArg = Homo-Arginine, NMeLeu, Oic = Unnatural amino acid	Derived from pyr-apelin-13	Treatment of Chronic Hepatic Failure	N.A.	0.5 mg/kg	10.3	Male SD rats plasma protease	Scintillation proximity assay	Male SD rats plasma	In Vivo	None	None	Rat GTPγS (nM) EC50 ± SE =7.42 ± 0.9
5115	32803073	2020	GSLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNL-AzF-AITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM	Pal-Rb	169	Free	Free	Linear	L	Conjugation of palmitic acid at AzF, biotinylated labelling, , (AzF) was incorporated into the position 126 on the repebody followed by lipid conjugation	Synthetic	Antitumor	Blood was collected in predetermined time points postinjection (n = 5; 0.05, 0.5, 1, 2, 4, 6, 12 and 24 h	10 mg/kg	10.7 (Elimination Half-Life)	Mice plasma protease	Sandwich ELISA	Mice plasma	In Vivo	PDB ID: 4J4L	None	The tumor size remained around 200 mm3 until 27 days when Pal-Rb was administered (p < 0.01), whereas tumor continued to grow over 600 mm3 when WT-Rb and PBS were injected.
5127	32608185	2020	GGRSFFLLRRIQGCRFRNTVDDY	125I-M-E5	22	Free	Tyrosine (Y) residue was added to E5 sequence and 125I was added	Linear	L	None	Synthetic	Anticancer (Treatment of Acute Myeloid Leukemia)	N.A.	50 µg/g	14.53 ± 6.04	Rats plasma protease	Gamma counter	Rats plasma	In Vivo	https://pmc.ncbi.nlm.nih.gov/articles/PMC4196105/#sec10	None	The cells that were pretreated with M-E5 showed significantly reduced migration compared with the CXCL12 group, and the inhibitory rate was 82.9% for the leukemic cells separated from the spleen and 59.1% for those separated from the BM
5161	32404523	2020	WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL	PEG40-NC	34	Free	Free	Linear	L	PEGylation at Asn637 in native gp41	Derived from the gp41 CHR	Therapeutic Efficacy In Simian-Human Immunodeficiency Virus-Acutely Infected Rhesus Monkeys	Blood samples (300 μl) were collected from the tail vein before administration and at different intervals after injection (3, 6, 9, 20, 23, 29, 48, 72, and 96 h)	1.7 μmol/kg	10.39	Rats plasma protease	HIV inhibition assay	Rats plasma	In Vivo	None	None	[EC50] = 18.51 nM for PEG40-NC (antiviral activity)
5189	35496622	2020	HGEGTFTSDLSQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK	Lixisenatide 1a	44	Free	Amidation	Linear	L	(X1) MPAs modification on Lys12	lixisenatide analogues	Antidiabetes	incubated at 37 °C for 6, 12, 24, and 48 h	1000 ng/mL	13.2	Rats blood plasma protease	LC-MS/MS	Rats blood plasma	In Vitro	None	None	EC50(nM) = 0.19 ± 0.02 for Lixisenatide 1a (in vitro GLP-1 receptor activation potency)
5192	35496622	2020	HGEGTFTSDLSKQMEEEAVRLFIEWLNGGPSSGAPPSKKKKKK	Lixisenatide 1d	44	Free	Amidation	Linear	L	(X1) MPAs modification on Lys12	lixisenatide analogues	Antidiabetes	incubated at 37 °C for 6, 12, 24, and 48 h	1000 ng/mL	13.1	Rats blood plasma protease	LC-MS/MS	Rats blood plasma	In Vitro	None	None	EC50(nM) = 0.085 ± 0.021 for Lixisenatide 1d (in vitro GLP-1 receptor activation potency)
5195	35496622	2020	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKK	Lixisenatide 1g	44	Free	Amidation	Linear	L	(X1) MPAs modification on Lys12	lixisenatide analogues	Antidiabetes	incubated at 37 °C for 6, 12, 24, and 48 h	1000 ng/mL	11.9	Rats blood plasma protease	LC-MS/MS	Rats blood plasma	In Vitro	None	None	EC50(nM) = 0.59 ± 0.16 for Lixisenatide 1g (in vitro GLP-1 receptor activation potency)
5203	32133341	2020	CNCKAPETARCAIRCVIFTSGGSRW	Apamin based analogs 3	25	Free	Free	Cyclic (C1-C11, C3-C15)	L	None	Apamin based analogs	Roles in metabolism, arousal, learning and memory	N.A.	0.05 μg/μl	12.8	Human serum protease	LC-MS	Human serum	In Vitro	None	None	Binding affinity pKi ± SEM [logM] = 6.65 ± 0.18
5218	32075870	2020	HGDGSFSDE-Nle-fTILDLLAARDFINWLIQTKITD	Apraglutide	33	Free	Amidation	Linear	L	Gly2, Nle10, D-Phe11, Leu16 modification	Derived from hGLP-2	Treatment of Short Bowel Syndrome	Blood samples were collected at multiple time points up to 6 h post injection	0.025 mg/kg	782 ± 365 (Elimination Half Life)	Göttingen minipigs plasma protease	LC-MS/MS	Göttingen minipigs plasma	In Vivo	None	None	EC50(nM) = 0.24 for hGLP-2 receptor
5221	32075870	2020	HGDGSFSDE-Nle-fTILDLLAARDFINWLIQTKITD	Apraglutide	33	Free	Amidation	Linear	L	Gly2, Nle10, D-Phe11, Leu16 modification	Derived from hGLP-2	Treatment of Short Bowel Syndrome	Blood samples were collected at multiple time points up to 169 h post injection	1 mg/kg	11.7 ± 1.4 (Terminal Half Life)	Rats plasma protease	LC-MS/MS	Rats plasma	In Vivo	None	None	EC50(nM) = 0.24 for hGLP-2 receptor
5268	N.A.	2020	CSWPA-hArg-CLHQDLC	Ac-(06-34-18) (HomoArg5)	12	Acetylation	Free	Linear	L	HomoArg6 replaces Arg (R)	Synthetic	Targets plasma kallikrein	N.A.	5 uM	10.7	Rats plasma protease	Waters Xevo TQ-MS	Rats plasma	In Vitro	None	US 201214350192 A	IC50(nM)(rat kallikrein) = 64
5275	N.A.	2020	CSFPY-hArg-CLHQDLC	Ac-(06-34-18) Phe2 Tyr4 HomoArg5	12	Acetylation	Free	Linear	L	HomoArg replaces Arg (R) at position 6,Tryptophan (W) at position 3 is replaced with Phe, alanine (A) at position 5 is replaced with Tyr	Synthetic	Targets plasma kallikrein	N.A.	5 uM	12.2	Rats plasma protease	Waters Xevo TQ-MS	Rats plasma	In Vitro	None	US 201214350192 A	IC50(nM)(rat kallikrein) = 19.7
5311	31654685	2019	HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRAEAAAAKEAAAAKEAAAAKA	Repebody-fused GLP-1 in complex with HSA	50	Repebody	GLP-1(7-36) (A8G) fused to the repebody in complex with HSA through linker (A(EAAAAK)3A) at C terminus	Linear	L	None	Synthetic	Antidiabetes	Mice were euthanized at predetermined time points (n = 5 mice each at 0.05, 0.5, 1, 3, 6, 12 and 24 h post-injection) to collect whole blood from the aorta abdominalis	25 nmol/kg	10.7 (Terminal Half Life)	Mice plasma protease	Sandwich ELISA	Mice plasma	In Vivo	PDB id: 5VAI	None	C57BLKS/J lar- Leprdb/Leprdb mice (n = 5 per group, 6 weeks) were intravenously injected with the repebody-fused GLP-1 in complex with HSA, an off-target repebody-fused GLP-1, native GLP-1, and PBS. The blood glucose levels were analyzed at each time point for 24 h. The HSA-specific repebody-fused GLP-1 showed a significant decrease (**p < 0.005) in blood glucose level compared to other cases
5326	31443181	2019	MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA	FcRn	365	Free	Free	Linear	L	None	Isolated from human gastric juice	Role in extending the serum half life of therapeutic antibodies	Blood collection at 0, 1.5, 3, 4.5, 6, 7.5, 9, 12, 15, 18, 21, 24, 27, 30, 33, 36 hrs	N.A.	10.6	PBMC lysate protease (African American)	LC-MS/MS	PBMC lysate (African American)	In Vitro	Uniprot id: P55899	None	N.A.
5327	31443181	2019	MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA	FcRn	365	Free	Free	Linear	L	None	Isolated from human gastric juice	Role in extending the serum half life of therapeutic antibodies	Blood collection at 0, 1.5, 3, 4.5, 6, 7.5, 9, 12, 15, 18, 21, 24, 27, 30, 33, 36 hrs	N.A.	11.6	PBMC lysate protease (African American)	LC-MS/MS	PBMC lysate (African American)	In Vitro	Uniprot id: P55899	None	N.A.
5338	31453257	2019	N.A.	Pept. A	N.A.	Free	Free	Cyclic	L	N.A.	N.A.	Therapeutic agent against a CNS-related disorder	Blood (100 µl) and CSF (100 µl) aliquots for drug concentration assessment were collected pre-dose, on study day 1 at 0.5, 1.5, 3, 6, and 24 h post first dose, and on study day 2 at 1.5 h post the second dose (corresponding to 25.5 h from study start)	4.2 mg/kg	14.3 ± 5.5 (Terminal Half Life)	göttingen Minipig Csf Lumbar Protease	LC-MS/MS	Göttingen minipigs CSF lumbar	In Vivo	None	None	N.A.
5358	31235532	2019	LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC	CNP-38	38	Free	Free	Cyclic (1 Disulfide Bond)	L	None	CNP-38 analog	Treatment of Comorbidities Associated with Fibroblast Growth Factor Receptor 3–related Skeletal Dysplasias	4 days	100 μg/ml	12.6 ± 3.9	Recombinant human NEP protease	HPLC-UV	Recombinant human NEP (2.5 mg/ml) + digest buffer (50 mM Tris-HCl, 10 mM NaCl, pH 7.4)	In Vitro	None	None	Ratio IC50 CNP-38/IC50 CNP-38 conjugate = 100 (NPR-C Affinity)
5364	31194563	2019	CARSKNKDC	Fasudil in CAR-liposome	9	Conjugation of amino groups of the lipids of liposomes with CAR peptide at N terminal Cys	Amidation	Linear	L	None	Synthetic	Treatment of Pulmonary Arterial Hypertension	N.A.	3 mg/kg	12.9 ± 4.6	Sham rats plasma protease	LC–MS/MS	Sham rats plasma	In Vivo	None	None	N.A.
5372	31156041	2019	LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQAAADYKDDDDKAADYKDDDDK	AD-114-Im7 PEG 30K	118	Free	lm7-PEG30K	Linear	L	None	Fusion protein of AD-114 with lm7	Attenuates Renal fibrosis through blockade Of CXCR	Blood samples were collected 5 min, 2, 6, 12, 24, 72 h post dosing	3 mg/kg	11.85	Mouse plasma protease	LC–MS/MS	Mouse plasma	In Vivo	PDB id: >5AEA_1	None	Kd(nM) = 0.7 (Human CXCR4 affinity) for AD-114-Im7-FH-PEG 30K
5376	31156041	2019	LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQAAADYKDDDDKAADYKDDDDK	AD-114-PA600-6H	118	Free	PA-600-6H	Linear	L	None	Fusion protein of AD-114 with PA600	Attenuates Renal fibrosis through blockade Of CXCR	Blood samples were collected at 15, 30 min, 1, 2, 3, 4, 8, 12,18, 24, 36, 48 and 72 h post dosing	10 mg/kg	10.25	Mouse plasma protease	ELISA	Mouse plasma	In Vivo	PDB id: >5AEA_1	None	Kd(nM) = 5.2 (Human CXCR4 affinity) for AD-114-Im7-FH-PEG 30K
5380	31156041	2019	LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQAAADYKDDDDKAADYKDDDDK	AD-114-PA600	118	Free	PA-600	Linear	L	None	Fusion protein of AD-114 with PA600	Attenuates Renal fibrosis through blockade Of CXCR	Blood samples were collected pre-dosing and at the following time points post-dosing: 5 min, 1, 4, 12, 24, 48, 96, 168 h.	3 mg/kg	10.2 ± 3.9	Cynomolgus monkeys plasma protease	LC–MS/MS	Cynomolgus monkeys plasma dosed at Day 1	In Vivo	PDB id: >5AEA_1	None	Kd(nM) = 4 (Human CXCR4 affinity) for AD-114-Im7-FH-PEG 30K
5394	31083740	2019	HSEGTFTSDVSSYLEGQAAKEFIAWLVKGGVKALIDEILAA	SKL-18287	41	Free	Amidation	Linear	L	3H labeling at Tyr, Ser8 modification	GLP-1 analogs	Antidiabetes	Blood samples were collected via the jugular vein for rats, the cephalic vein for monkeys, and the jugular venous or femoral venous catheter for mini-pigs, using a heparinized syringe at 0.25, 0.5, 1, 2, 4, 6, 8, 10, 12, 24, 48, and 72 h for subcutaneous administration	17.4 µ/kg	11.4 ± 1.0 (Elimination Half Life)	Cynomolgus monkeys plasma protease	LC-MS/MS	Cynomolgus monkeys plasma	In Vivo	None	None	N.A.
5395	31083740	2019	HSEGTFTSDVSSYLEGQAAKEFIAWLVKGGVKALIDEILAA	SKL-18287	41	Free	Amidation	Linear	L	3H labeling at Tyr, Ser8 modification	GLP-1 analogs	Antidiabetes	Blood samples were collected via the jugular vein for rats, the cephalic vein for monkeys, and the jugular venous or femoral venous catheter for mini-pigs, using a heparinized syringe at 0.083, 0.25, 0.5, 1, 2, 4, 6, 8, 10, 12, 24, 48, and 72h for intravenous	17.4 µ/kg	12.9 ± 1.0 (Elimination Half Life)	Göttingen minipigs plasma protease	LC-MS/MS	Göttingen minipigs plasma	In Vivo	None	None	N.A.
5504	30606721	2019	ACYNEFGCEDFYDIC	BCY-B5	15	Acetylation	Free	Cyclic (Cyclized With 1,3,5-Trismethylbenzene On C2, C8, C15)	L	None	Bicyclic peptide derivative	For imaging and targeting of proteins overexpressed by tumors	37C up to 24 hours	4 μmol/L	11.5	Mouse plasma protease	LC-MS/MS	Mouse plasma	In Vitro	None	None	N.A.
5515	30605634	2019	pGlu-RPRLSHKGPMPF	(Pyr)1-apelin-13	13	pGlu = Pyroglutamate	Free	Linear	L	None	Apelin analogs	Hemodynamic Effects In Humans	N.A.	50 mg/kg	11	Rats plasma protease	LC-MS/MS	Rats plasma	In Vivo	None	None	N.A.
5517	30605634	2019	pGlu-RPRLSHKGPMPF	(Pyr)1-apelin-13	13	pGlu = Pyroglutamate	Free	Linear	L	None	Apelin analogs	Hemodynamic Effects In Humans	N.A.	10 mg/kg	11	Dogs plasma protease	LC-MS/MS	Dogs plasma	In Vivo	None	None	N.A.
5538	30504081	2019	(VPKEG)80	VPKEG80	400	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =K, X2= E	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	12.4 ± 0.1	N.A.	N.A.	N.A.	In Vitro	None	None	EC50 = 17 nM for GLP1-VPKEG120
5539	30504081	2019	(VPKEG)120	VPKEG120	600	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =K, X2= E	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	12.9 ± 0.2	N.A.	N.A.	N.A.	In Vitro	None	None	EC50 = 17 nM for GLP1-VPKEG120
5542	30504081	2019	(VPKEG)120	VPKEG120	600	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =K, X2= E	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	12.0 ± 0.4	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	EC50 = 17 nM for GLP1-VPKEG120
5544	30504081	2019	(VPKDG)120	VPKDG120	600	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =K, X2= D	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	10.8 ± 0.2	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	N.A.
5546	30504081	2019	(VPGAG)120	VPGAG120	600	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =G , X2= A	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	10.6 ± 1.6	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	EC50 = 10 nM for GLP1-VPGAG160
5547	30504081	2019	(VPGAG)160	VPGAG160	800	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =G , X2= A	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	12.4 ± 0.8	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	EC50 = 10 nM for GLP1-VPGAG160
5549	30504081	2019	(VPKDG)120	VPKDG120	600	A leader sequence (GCGYPG) was added to the N-terminus of the ZIPPs and ELPs to site specifically conjugate the maleimide derivative of Alexa488	Free	Linear	L	X1 =K, X2= D	Zwitterionic polypeptide derivative	Intrinsically disordered zwitterionic polypeptides for drug delivery	10 μl blood samples were collected into tubes with 100 μl of heparin at 40 s, 15 min, 0.5, 2, 4, 8, 24, 48 and 72 h after injection into the tail vein	300 μM	11.8 ± 1	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	N.A.
5633	30565900	2018	RGD	DOX@PLEPMPss-cRGD	3	PCL-PEG	Free	Cyclic (N-C terminal end)	L	None	Synthetic	Anticancer	The plasma was collected after injection at predetermined time points (1, 3, 6, 12, and 24 h)	2 mg/kg	11.81 ± 0.67 (T1/2b)	Mice plasma protease	fluorescence spectrometry	mice plasma	In Vivo	None	None	The IC50 value (i.e., the concentration resulting in 50% cell inhibition) forDOX@Cu-PLEPMPsscRGD micelles was 2.884 µg mL−1
5634	30565900	2018	RGD	DOX@Cu-PLEPMPss-cRGD	3	PCL-PEG	Free	Cyclic (N-C terminal end)	L	None	Synthetic	Anticancer	The plasma was collected after injection at predetermined time points (1, 3, 6, 12, and 24 h)	2 mg/kg	12.20 ± 0.73 (T1/2b)	Mice plasma protease	fluorescence spectrometry	mice plasma	In Vivo	None	None	The IC50 value (i.e., the concentration resulting in 50% cell inhibition) forDOX@Cu-PLEPMPsscRGD micelles was 2.884 µg mL−1
5637	30496575	2018	GPVPTSKPTTTKGGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTSSGSSSSSSSKAPPPSLPSPSRLPGPSDTPILPQNGS	rhIFN-λ1-CTPON	218	Free	Human chorionic gonadotropin β subunit carboxyl-terminal peptide (CTP) and an N-glycosylation sequence linked to its C-terminus via linker	Linear	L	None	Recombinant human interferon-λ1 derivative	Antiviral, Antiproliferation, And Nk Cell Cytotoxicity-Promoting Activities	Venous blood was collected at 0.5 h, 1 h, 2 h, 4 h, 8 h, and 24 h post-injection	40 μg/kg	10.326 ± 0.87	Mice blood protease	ELISA	Mice blood sample	In Vivo	None	None	Antiviral activity of the purified rhIFN-λ1 expressed by CHO cells was 2.5 × 105 IU/mg
5662	30096651	2018	HGEGTYTNDVTEYLEEEAAKEFIEWLIKGKPSSGAPPPSCHGEGTYTNDVTEYLEEEAAKEFIEWLIKGKPSSGAPPPSC	Analogue 6	80	Free	C terminal Cys extension for bis-maleimide linkage	Linear	L	Conjugation of Palmitic acid at Lys20 (single monomer) , dimerization	Dimeric lipidated Xenopus GLP-1 analogues	Antidiabetes	At 1, 2, 3, 4, 6, 12, 24 and 48 h after injection, three Kunming mice were sacrificed at each time point and blood samples (~200 mL) were collected through extracting eyeball	50 nmol/kg	10.8 ± 0.8	Kunming mice plasma protease	LC-MS/MS	Kunming mice plasma	In Vivo	None	None	EC50 = 1.4 ± 0.5 nM in HEK293 cells
5663	30096651	2018	HGEGTYTNDVTEYLEEEAAKEFIEWLIKGKPSSGAPPPSCHGEGTYTNDVTEYLEEEAAKEFIEWLIKGKPSSGAPPPSC	Analogue 6	80	Free	C terminal Cys extension for bis-maleimide linkage	Linear	L	Conjugation of Palmitic acid at Lys20 (single monomer) , dimerization	Dimeric lipidated Xenopus GLP-1 analogues	Antidiabetes	Blood samples (100e150 mL) were obtained from fundus venous plexus and stored in polyethylene tubes containing heparin	50 nmol/kg	12.9 ± 3.6	SD rats plasma protease	LC-MS/MS	SD rats plasma	In Vivo	None	None	EC50 = 1.4 ± 0.5 nM in HEK293 cells
5693	30012756	2018	L-threonyl-L-tryptophanyl-L-isoleucyl-L-2,4-diaminobutyryl-L-ornithyl-D-2,4-diaminobutyryl-L-2,4-diaminobutyryl-L-tryptophanyl-L-2,4-diaminobutyryl-L-2,4-diaminobutyryl-L-alanyl-L-seryl,D-prolyl-L-prolyl	Murepavadin	14	Free	Free	Cyclic (N-C terminal end)	Mix	Acetate	Synthetic	Antimicrobial	Blood samples were taken predose and 1, 2, 3, 3.5, 4, 5, 6, 9, 15, and 27 h after the start of infusion. For subjects with renal impairment, additional samples were taken at 30, 36, and 48 h, and at 72 h for subjects with severe renal function impairment	2.2 mg/kg	14.1	Human plasma protease	LC-MS with electrospray ionization assay	Human plasma (Mild Renal impairment group)	In Vivo	https://sci-hub.st/10.1080/14787210.2018.1441024	None	MIC50 = 0.12 mg/L against P. aeruginosa
5700	29926478	2018	HSQGTFTSDKSEYLDSERARDFVAWLEAG	MEDI0382	29	Free	Free	Linear	L	Palmitic-Glu conjugation at Lys	Synthetic	Antidiabetes and Non‐Alcoholic Steatohepatitis	N.A.	30 μg	11.43	Human plasma protease	LC-MS	Human plasma	In Vivo	PubChem CID: 134694273	None	N.A.
5701	29926478	2018	HSQGTFTSDKSEYLDSERARDFVAWLEAG	MEDI0382	29	Free	Free	Linear	L	Palmitic-Glu conjugation at Lys	Synthetic	Antidiabetes and Non‐Alcoholic Steatohepatitis	N.A.	100 μg	12.07	Human plasma protease	LC-MS	Human plasma	In Vivo	PubChem CID: 134694273	None	N.A.
5702	29926478	2018	HSQGTFTSDKSEYLDSERARDFVAWLEAG	MEDI0382	29	Free	Free	Linear	L	Palmitic-Glu conjugation at Lys	Synthetic	Antidiabetes and Non‐Alcoholic Steatohepatitis	N.A.	150 μg	10.97	Human plasma protease	LC-MS	Human plasma	In Vivo	PubChem CID: 134694273	None	N.A.
5705	29799205	2018	HGEGTYTNDVTEYLEEEAA-X4-EFIEWLIKGKPSSGAPPPS	5b	39	Free	Free	Linear	L	X4 = structure given in paper	GLP-1 analogs	Antidiabetes	Serial blood samples (100–200 µL) were collected from fundus venous plexus in microcentrifuge tubes (EDTA containing) at 0, 1, 2, 3, 4, 6, 12, 24 and 48 h	50 nmol/kg	11.0 ± 1.2	SD rats plasma protease	LC-MS/MS.	SD rats plasma	In Vivo	None	None	N.A.
5742	29732120	2018	RGDfV	Cilen	5	Free	Free	Macrocyclic (N-C terminal end)	Mix	Methylation at Phenylalanine (D-form)	Synthetic	Glioblastoma therapy	At various time points (0, 1, 3, 5. 7, 9, 12, 24, 36, 48, 60 and 72 h)	1 mg/ml	12	Human serum protease	HPLC	Human serum	In Vitro	None	None	IC50 value of 11 shows that 11 is poorer than Cilen
5882	29329072	2018	YFLNGRPRN	Compound 32	8	Acetylation	Amidation	Linear	L	N(benzyl)Gly modfication at position 4	NMU-analogs	Regulation Of Feeding Behavior, The Stress Response And Nociception	37 °C	112 µM	837.4 ± 27.8	Human plasma protease	RP-HPLC	Human plasma	In Vitro	None	None	EC50(nM) = 172.2, IC50(nM) = 83.1 for hNMUR1 and EC50(nM) = 1278, IC50(nM) = 1019 for hNMUR2
5900	N.A.	2018	QRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVGSSGSSGSSGSGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIDTNGKWNDRACGEKRLVVCEFGGSPSSSSSSAWSHPQFEK	TRAIL-ASPD_F335D	347	Free	C-type lectin domain of human SP-D joined with Strep-tag II using linker	Linear	L	Phe355 -> Asp355 modification	Trail-SPD Fusion Protein	Therapeutic, diagnostic and/or research applications	Serum samples were collected after several time points (predose, 5 min., 30 min., 2H, 6H and 24H)	10 μg	14	CD1 mice serum protease	ELISA	CD1 mice serum	In Vivo	None	EP 17197297 A	Five hours of co-incubation of primary human hepatocytes with trimeric TRAIL-ASPD_F335D together with chemotherapeutic drugs induced no caspase activity (E)
5954	28821462	2017	MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNESGSSGGSGSSGGSGGGDEADGSRGSQKAGVDE	LCFN144	183	Free	Fusing the XTEN peptide of 144 amino acids through a linker	Linear	L	Gly-rich linker (GSSGGSGSSGGSGGGDEADGSRGSQKAGVDE) is used, Cy5 dye (Lumiprobe) were chemically conjugated to the amine groups of lysine residues on the exterior surface of the nanocages	wtFN derivative	Antitumor	N.A.	50 mg/kg	11.3 ± 1.0	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	N.A.
5955	28821462	2017	MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNESGSSGGSGSSGGSGGGDEADGSRGSQKAGVDE	LCFN288	183	Free	Fusing the XTEN peptide of 288 amino acids through a linker	Linear	L	Gly-rich linker (GSSGGSGSSGGSGGGDEADGSRGSQKAGVDE) is used, Cy5 dye (Lumiprobe) were chemically conjugated to the amine groups of lysine residues on the exterior surface of the nanocages	wtFN derivative	Antitumor	N.A.	50 mg/kg	10.2 ± 0.3	Mice plasma protease	Fluorescence assay	Mice plasma	In Vivo	None	None	N.A.
5978	28714475	2017	EYEKEYE	Tag	7	Fluorescein (F)	Amidation	Linear	L	Lys4 linked with Palm fatty acid	Synthetic	Increases Half Life	N.A.	0.25 mg/kg	12.3 ± 0.4 (T1/2b)	Rats plasma protease	RP-HPLC using a fluorescence detector	Rats plasma	In Vivo	None	None	Albumin binding (Kd) (nM) = 220±30 for rat albumin
6029	28356733	2017	MHSDAVFTDQYTRLRKQLAAKKYLQSLKQKRY	SCD	32	Free	Chitosan-modified SeNP (SC)	Linear	L	None	Peptide-conjugated selenium nanoparticles	Antidiabetes	Orbital blood was collected at each time point before dosing and from 0.5 to 24 h post dosing	1 mg/kg	14.12	DB/DB mice orbital blood protease	LC-MS/MS	DB/DB mice orbital blood sample	In Vivo	None	None	IC50 of SC for INS-1 cells was 66.10 μM
6035	28281868	2017	DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLMALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD	HSA-eTGFBR2	697	Free	eTGFBR2 fused at the C-terminal of HSA	Linear	L	None	Synthetic	Neutralize TGF-Β1 activity	Blood samples were collected 5 min, 15 min, 30 min, 1 h, 2 h, 6 h,12 h, 24 h	3 nmol/kg	11.84	Mice serum protease	Human TGF-b RII Duo Set ELISA	Mice serum	In Vivo	pdb id: 4P7U, 7DJN	None	KD = 1.42* 10-8M of HSA-eTGFBR2 for TGF-B1
6144	27058430	2016	KIKIPWGKVKDFLVGGMKAV	Bicarinalin	20	Free	Amidation	Linear	L	None	Ant venom peptide	Antimicrobial	37 ◦C until 48 h	N.A.	15	Human serum protease	LC-MS	Human serum	In Vitro	None	None	Bicarinalin displayed no cytotoxicity against human lymphocytes in concentrations ranging from 0.066 to 8.5 mol L−1 and its LC50 value was 67.8 mol L−1
6145	27058430	2016	KIKIPWGKVKDFLVGGMKAV	Bicarinalin	20	Free	Amidation	Linear	L	None	Ant venom peptide	Antimicrobial	37 ◦C until 48 h	N.A.	15	Human serum protease	LC-MS	Human serum	In Vitro	None	None	MIC [micromole/L] = 24.4, 5.8, 12.2, 8.7, 5.4 for E.coli, C.sakazakii, P.aeruginosa CIP 82118, P.aeruginosa [R]ATCC 15442, S.enterica respectively.
6146	27058430	2016	KIKIPWGKVKDFLVGGMKAV	Bicarinalin	20	Free	Amidation	Linear	L	None	Ant venom peptide	Antimicrobial	37 ◦C until 48 h	N.A.	15	Human serum protease	LC-MS	Human serum	In Vitro	None	None	MIC [micromole/L] = 12.2, 3, 8.7, 0.45, 24.4 for E.hirae, S.aureus, MRSA, S.xylosus, B.subtilis respectively
6147	27058430	2016	KIKIPWGKVKDFLVGGMKAV	Bicarinalin	20	Free	Amidation	Linear	L	None	Ant venom peptide	Antimicrobial	37 ◦C until 48 h	N.A.	15	Human serum protease	LC-MS	Human serum	In Vitro	None	None	MIC [micromole/L] = 0.75, 17.3, 17.3, 97.5, 6.1 for A.niger, C.albicans, C.albicans[R], G.candidum, S.cerevisiae and MIC[micromole/L] = 1.5 for L.infantum
6148	32263229	2016	RGDfC	iT-P/PTX NPs	5	Free	TPGS(D-a-tocopherol polyethylene glycol succinate) linked with poly(lactide) using disulfide linkage, cRGD further conjugated to NP surface	Cyclic (RGDfC)	Mix	D-Phe at position 4	Synthetic	Anticancer	Blood samples were collected in EP tubes containing 20 mL of 1000 U heparin per mL at 0.5, 1, 2, 4, 8, 12, 24, 48 and 72 h for each group.	10 mg/ kg	12.68 ± 0.81	SD rats plasma protease	HPLC	SD rats plasma	In Vivo	None	None	IC50 = 1.90 ± 0.28 mg/mL incubated with A2780 cell
6165	26808305	2016	SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF	αAnalogue	37	Fatty acid moiety attached to Ser1 at N terminal	Amidation	Cyclic (Disulfide Bridge Between Positions 2 And 7)	L	None	CGRP analogue	Vasodilatory effect	Blood (200 µl) was sampled from vena sublingualis from anaesthetised rats at pre-dose and at 0.5, 1, 3, 7 and 24 h post dosing	151 nmol/kg	10.2 ± 0.9	SD rats plasma protease	ELISA	SD rats plasma	In Vivo	https://sci-hub.st/10.1126/science.2994212,	None	N.A.
6169	26808199	2016	LRHYLNLLTRQRY	PYY24–36-Leu31 conjugates 5	13	R5( structure given in paper) at NH terminal	Amidation	Linear	L	Leu31 substituitions	PYY analog	Antiobesity	An amount of 100 lL of plasma was removed from the incubations at 0, 1, 2, 4, 6,8, 12, and 24 h time-point	1000 ng/mL	>12	SD rats plasma protease	LC–MS/MS	SD rats plasma	In Vitro	None	None	HSA binding correlated well with plasma stability
6170	26808199	2016	LRHYLNLLTRQRY	PYY24–36-Leu31 conjugates 7	13	R7( structure given in paper) at NH terminal	Amidation	Linear	L	Leu31 substituitions	PYY analog	Antiobesity	An amount of 100 lL of plasma was removed from the incubations at 0, 1, 2, 4, 6,8, 12, and 24 h time-point	1000 ng/mL	>12	SD rats plasma protease	LC–MS/MS	SD rats plasma	In Vitro	None	None	HSA binding correlated well with plasma stability
6171	26808199	2016	LRHYLNLLTRQRY	PYY24–36-Leu31 conjugates 9	13	R9( structure given in paper) at NH terminal	Amidation	Linear	L	Leu31 substituitions	PYY analog	Antiobesity	An amount of 100 lL of plasma was removed from the incubations at 0, 1, 2, 4, 6,8, 12, and 24 h time-point	1000 ng/mL	>12	SD rats plasma protease	LC–MS/MS	SD rats plasma	In Vitro	None	None	HSA binding correlated well with plasma stability
6175	26806490	2016	SSSSKAPPPSLPSPSRLPGPSDTPILPQCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE-SSSSKAPPPSLPSPSRLPGPSDTPILPQ	CTP-IFN-CTP	221	CTP ( the terminal peptide of the β subunit of human chorionic gonadotropin (hCG))	CTP ( the terminal peptide of the β subunit of human chorionic gonadotropin (hCG))	Linear	L	None	Recombinant human IFN-α2b	Antiviral, Anticancer	N.A.	1*106 U / 200 g	13.4 ± 1.5 (Elimination Half Life)	Wistar rats plasma protease	N.A.	Female Wistar rats plasma	In Vivo	None	None	Specific antiviral bioactivity (U ng−1) = 44 ± 3, Specific antiproliferative bioactivity (U ng−1) = 9 ± 1
6189	26725426	2016	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Exenatide	39	Free	Amidation	Linear	L	None	Exendin-4 analogs	Antihyperglycemic	N.A.	23.88 nmol/mL	10.16	Carboxy-Peptidase A	Mass spectrometry	Intestinal fluid buffer (pH 6.8) with CPA (0.2 U/mL)	In Vitro	PDB id: 7MLL	None	N.A.
6190	26725426	2016	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Exenatide	39	Free	Amidation	Linear	L	None	Exendin-4 analogs	Antihyperglycemic	N.A.	23.88 nmol/mL	12.38	Trypsin	Mass spectrometry	Intestinal fluid buffer (pH 6.8) with Trypsin (0.2 U/mL)	In Vitro	PDB id: 7MLL	None	N.A.
6191	26725426	2016	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Exenatide	39	Free	Amidation	Linear	L	None	Exendin-4 analogs	Antihyperglycemic	N.A.	23.88 nmol/mL	14.28	Pepsin	Mass spectrometry	Gastric fluid solution (pH 1.2) with Pepsin (0.2 U/mL)	In Vitro	PDB id: 7MLL	None	N.A.
6211	26713839	2016	SSSSKAPPPSLPSPSRLPGPSDTPILPQFPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF-(SSSSKAPPPSLPSPSRLPGPSDTPILPQSSSSKAPPPSLPSPSRLPGPSDTPILPQ	MOD-4023	275	CTP fused to hGH	2 CTP fused	Linear	L	None	Synthetic	Treatment of GHD	Day 1	1.5 mg/kg	12.76 ± 2.06	Monkeys serum protease	Sandwich ELISA	Monkeys serum	In Vivo	https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU	None	EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells)
6218	26713839	2016	SSSSKAPPPSLPSPSRLPGPSDTPILPQFPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF-(SSSSKAPPPSLPSPSRLPGPSDTPILPQSSSSKAPPPSLPSPSRLPGPSDTPILPQ	MOD-4023	275	CTP fused to hGH	2 CTP fused	Linear	L	None	Synthetic	Treatment of GHD	Day 181	1.5 mg/kg	17.01 ± 6.91	Monkeys serum protease	Sandwich ELISA	Monkeys serum	In Vivo	https://pmc.ncbi.nlm.nih.gov/articles/PMC3159989/, PDB id: 1HGU	None	EC50 = 15.8 ± 2.0 ng/ml (Proliferation of BAFB2B2 cells)