| 1405 | SEQ ID32 | RSCIATIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1406 | SEQ ID33 | RSCIDAIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1407 | SEQ ID34 | RSCIDTAPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1408 | SEQ ID35 | RSCIDTIAKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1409 | SEQ ID36 | RSCIDTIPASRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1410 | SEQ ID37 | RSCIDTIPKARCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1411 | SEQ ID38 | RSCIDTIPKSACTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1412 | SEQ ID39 | RSCIDTIPKSRCAAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1413 | SEQ ID40 | RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1414 | SEQ ID41 | RSCIDTIPKSRCTAFACKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1415 | SEQ ID42 | RSCIDTIPKSRCTAFQCAHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1416 | SEQ ID43 | RSCIDTIPKSRCTAFQCKASMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1417 | SEQ ID44 | RSCIDTIPKSRCTAFQCKHAMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1418 | SEQ ID45 | RSCIDTIPKSRCTAFQCKHSAKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1419 | SEQ ID46 | RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1420 | SEQ ID47 | RSCIDTIPKSRCTAFQCKHSMKARLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1421 | SEQ ID48 | RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1422 | SEQ ID49 | RSCIDTIPKSRCTAFQCKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1423 | SEQ ID50 | RSCIDTIPKSRCTAFQCKHSMKYRLAFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1424 | SEQ ID51 | RSCIDTIPKSRCTAFQCKHSMKYRLSACRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1425 | SEQ ID52 | RSCIDTIPKSRCTAFQCKHSMKYRLSFCAKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1426 | SEQ ID53 | RSCIDTIPKSRCTAPQCKHSMKYRLSFCRATCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1427 | SEQ ID54 | RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKACGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1428 | SEQ ID55 | RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKTCGAC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1433 | SEQ ID60 | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Cyclic (C3-C35, C12 | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1434 | SEQ ID61 | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Cyclic (C3-C35) | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1435 | Nef2-19 | GGKWSKSSVIGWPAVRERMRR | 21 | L | None | None | None | Linear | Natural | NL4.3 strain of HIV-1 | T -cells | Downregulates CD4 and IL-2 | In vitro | CD4+ T-cell lines, PBMC, MT-2 cells, Jurkat cells | NA | None | Hummoral Immune Response assay | NA | NA | US 6197583 B1 | 2001 |
| 1437 | None | ew | 2 | D | None | None | None | Linear | Synthetic | Not mentioned | NA | Inhibits cell proliferation | In vivo | None | NA | Mice spleen cells | Thymidine suicide test | 0.02μg/ml | NA | US 6410515 B1 | 2002 |
| 1438 | SEQ ID10 | rlllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1439 | SEQ ID11 | rvllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1440 | SEQ ID12 | rillrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1441 | SEQ ID13 | rlvlrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1442 | SEQ ID14 | rlilrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1443 | SEQ ID15 | rllvrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1444 | SEQ ID16 | rllirlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1445 | SEQ ID17 | rlllrvllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1446 | SEQ ID18 | rlllrillgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1447 | SEQ ID19 | rlllrlvlgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1448 | SEQ ID20 | rlllrlilgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1449 | SEQ ID21 | rlllrllvgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1450 | SEQ ID22 | rlllrlligy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1451 | SEQ ID23 | rwllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1452 | SEQ ID24 | rlwlrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1453 | SEQ ID25 | rllwrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1454 | SEQ ID26 | rlllrwllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1455 | SEQ ID27 | rlllrlwlgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1456 | SEQ ID28 | rlllrllwgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1457 | SEQ ID29 | ryllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1458 | SEQ ID30 | rlylrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1459 | SEQ ID31 | rllyrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
