| 1322 | None | GLDLLTAEQGGICLALQEKCCF | 22 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T13 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1324 | HTLV-I Virus | QNRRGLDLLFWEQGGLCLALQEQCRF | 26 | L | None | None | None | Linear | Protein Derived | Human T-cell Leukemia Virus envelope proteins | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T15 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1326 | Feline Virus | QNRRGLDILFLQEGGLCAALKEECCF | 26 | L | None | None | None | Linear | Protein Derived | Feline virus envelope proteins | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T17 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1329 | None | QNRRGLDLLFLKEGGL | 16 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T20 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1330 | Formula (IVb) CS-1 | QNRRGLDLLFWEQGGL | 16 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T21 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1331 | Formula (IVc) CS-2 | QNRLALDYLLAAEGGV | 16 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T22 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1332 | Formula (IVd) CS-3 | QARILAVERYLLDQQL | 16 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T23 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1333 | Formula (Ive)-CS-SRV 17 | QNRRGLDLLTAEQGGI | 16 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T24 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1334 | None | QNRLDYLLAAEGGVCGKFNLTNYC | 24 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T25 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1337 | None | AQNRRGLDLLFLKEGGL | 17 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T28 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1338 | None | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Protein Derived | Retrovial envelope protein | Human Monocytes | Inhibit CTLL-2 proliferation | Both | Human mononuclear cells, Murine CTLL-2 cells, Balb/3T3 cells, NIH/3T29 | NA | BALB/c and NIH/Swiss mice, Rabbits | Hummoral Immune Response assay, Monocytes O2 release assay | NA | BSA | US 4822606 | 1989 |
| 1347 | Formula 9 | [RKD-NH-CH2]2 | 6 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1348 | Formula 10 | RKD-NH-CH2-CH2-NH-DKR | 6 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1349 | Formula 11 | [RKDV-NH-CH2]2 | 8 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1350 | Formula 12 | [RLDV-NH-CH2]2 | 8 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1351 | Formula 13 | KSKL | 4 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1352 | Formula 14 | SKL | 3 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1353 | Formula 15 | SSST | 4 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1354 | Formula 16 | LET | 3 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1355 | Formula 17 | LTET | 4 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1356 | Formula 18 | PKLT | 4 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1357 | Formula 19 | KKTE | 4 | L | None | None | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1358 | Formula 20 | KHL | 3 | L | None | Amidation | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1364 | CB11P | PTGPLGPKGQTGELGIAGFKGEQGPK | 26 | L | None | None | None | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5720955 | 1998 |
| 1367 | CB11P | PTGPLGPKGQTGELGIAGFKGEQGPK | 26 | L | None | None | None | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5783188 | 1998 |
| 1370 | CB11P | PTGPLGPKGQTGELGIAGFKGEQGPK | 26 | L | None | None | None | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5843445 | 1998 |
| 1371 | A2.94-112 | TLQRMYGCDVGSDWRFLRG | 19 | L | None | None | None | Linear | Protein Derived | α2 domain of HLA-A2 | B-Lymphoblastoid cells (B-cell) | Inhibit by binding to variable T cell receptor | In vitro | AJY CTL cell line | NA | None | Hummoral Immune Response assay | NA | NA | US 5888512 | 1999 |
| 1372 | A2.98-113 | MYGCDVGSDWRFLRGY | 16 | L | None | None | None | Linear | Protein Derived | α2 domain of HLA-A2 | B-Lymphoblastoid cells (B-cell) | Inhibit by binding to variable T cell receptor | In vitro | AJY CTL cell line | NA | None | Hummoral Immune Response assay | NA | NA | US 5888512 | 1999 |
| 1373 | A2.101-108 | CDVGSDWR | 8 | L | None | None | None | Linear | Protein Derived | α2 domain of HLA-A2 | B-Lymphoblastoid cells (B-cell) | Inhibit by binding to variable T cell receptor | In vitro | JY cells (HKA-A2, B7, DR4,6) | NA | None | Hummoral Immune Response assay | NA | NA | US 5888512 | 1999 |
| 1374 | Nef2-19 | GGKWSKSSVIGWPAVRERMRR | 21 | L | None | None | None | Linear | Natural | NL4.3 strain of HIV-1 | T -cells | Downregulates CD4 and IL-2 | In vitro | MT-2 cells | NA | None | Electroporation technique | NA | GST | US 5962635 | 1999 |
| 1376 | SEQ ID3 | CIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 33 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1378 | SEQ ID5 | RSCIDTIPKSRCTAFECKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1379 | SEQ ID6 | RSCIDTIPKSRCTAFQCKKSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1380 | SEQ ID7 | RSCIDTIPKSRCTAFQCKHSMEYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1383 | SEQ ID10 | RSCATIPKSRCTAAQCKHSMKYRLSFCRKRCGTC | 34 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1384 | SEQ ID11 | RSCIDSTIPKSRCTAAQKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1385 | SEQ ID12 | RSCADTIPKSRCTAAQCKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1386 | SEQ ID13 | SSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1387 | SEQ ID14 | RSCIDTIPQSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1388 | SEQ ID15 | RSCIDTIPKSQCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1389 | SEQ ID16 | RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1390 | SEQ ID17 | RSCIDTIPKSQCTAWQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1391 | SEQ ID18 | RSCIDTIPKSQCTAFQCAHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1393 | SEQ ID20 | RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1397 | SEQ ID24 | RSCIDTIPKSRCTAFQCRHSMRYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1398 | SEQ ID25 | RSCIDTIPKSRCTAFQCKHSMKFRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1401 | SEQ ID28 | RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1402 | SEQ ID29 | ASCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1403 | SEQ ID30 | RACIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1404 | SEQ ID31 | RSCADTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
