Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 39| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB705 | 22156436 | NA | NA | MAPAAVAAAEAGSK | MAPAAVAAAEAGSK | 14 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1243.623 | NA |
| FMDB706 | 22156436 | NA | NA | DNIPIVIR | DNIPIVIR | 8 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 938.5549 | NA |
| FMDB707 | 22156436 | NA | NA | AIAGAGVLSGYDQLQILFFGK | AIAGAGVLSGYDQLQILFFGK | 21 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2167.1677 | NA |
| FMDB708 | 22156436 | NA | NA | GNQEKVLELVQR | GNQEKVLELVQR | 12 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS50 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1411.7783 | NA |
| FMDB709 | 22156436 | NA | NA | PAGSAAGAAP | PAGSAAGAAP | 10 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS51 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 769.8311 | NA |
| FMDB710 | 22156436 | NA | NA | EALEAMFL | EALEAMFL | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS52 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 924.1021 | NA |
| FMDB711 | 22156436 | NA | NA | AAGAAAAARSAGQCGR | AAGAAAAARSAGQCGR | 16 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS53 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1387.6738 | NA |
| FMDB712 | 22156436 | NA | NA | ITFAAYRR | ITFAAYRR | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS54 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 998.1621 | NA |
| FMDB713 | 22156436 | NA | NA | HPVPPKKK | HPVPPKKK | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS55 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 912.2177 | NA |
| FMDB714 | 22156436 | NA | NA | VFVDEGLEVLGWRPVPFNVSVVGRNAK | VFVDEGLEVLGWRPVPFNVSVVGRNAK | 27 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS56 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2982.608 | NA |
| FMDB715 | 22156436 | NA | NA | RLSLPAGAPVTVAVSP | RLSLPAGAPVTVAVSP | 16 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS57 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1535.8101 | NA |
| FMDB716 | 22156436 | NA | NA | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | 39 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS58 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4033.4843 | NA |
| FMDB717 | 22156436 | NA | NA | LCPVHRAADL | LCPVHRAADL | 10 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS59 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1095.3231 | NA |
| FMDB718 | 22156436 | NA | NA | PAEMVAAALDR | PAEMVAAALDR | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS60 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1484.7511 | NA |
| FMDB719 | 22156436 | NA | NA | KVALMSAGSMH | KVALMSAGSMH | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS61 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1131.2679 | NA |
| FMDB720 | 22156436 | NA | NA | DLADIPQQQRLMAGLALVVATVIFLK | DLADIPQQQRLMAGLALVVATVIFLK | 26 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS62 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2822.6092 | NA |
| FMDB721 | 22156436 | NA | NA | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | 34 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS63 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 3580.795 | NA |
| FMDB722 | 22156436 | NA | NA | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | 53 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5338.5201 | NA |
| FMDB723 | 22156436 | NA | NA | YEWEPTVPNFDVAKDVTDM | YEWEPTVPNFDVAKDVTDM | 19 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2255.0093 | NA |
| FMDB724 | 22156436 | NA | NA | GVSNAAVVAGGH | GVSNAAVVAGGH | 12 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1037.5254 | NA |
| FMDB725 | 22156436 | NA | NA | DAQEFKR | DAQEFKR | 7 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 892.4403 | NA |
| FMDB726 | 22156436 | NA | NA | PPGPGPGPPPPPGAAGRGGGG | PPGPGPGPPPPPGAAGRGGGG | 21 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1704.8721 | NA |
| FMDB727 | 22156436 | NA | NA | HKEMQAIFDVYIMFIN | HKEMQAIFDVYIMFIN | 16 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2000.3734 | NA |
| FMDB728 | 22156436 | NA | NA | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | 57 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5124.5196 | NA |
| FMDB729 | 22156436 | NA | NA | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | 52 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4921.2889 | NA |
| FMDB996 | 18627167 | NA | NA | DPVAPLQRSGPEI | DPVAPLQRSGPEI | 13 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | NA | 1149.6142 | 0.19 mg/mL |
| FMDB997 | 18627167 | NA | NA | PVAPQLSRGLL | PVAPQLSRGLL | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | NA | nanoLC-ESI-MS/MS | NA | 1149.687 | 0.19 mg/mL |
| FMDB998 | 18627167 | NA | NA | ELEIVMASPP | ELEIVMASPP | 10 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | NA | nanoLC-ESI-MS/MS | NA | 1084.5474 | 0.19 mg/mL |
| FMDB999 | 18627167 | NA | NA | QILLPRPGQAA | QILLPRPGQAA | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | NA | 1162.6822 | 0.19 mg/mL |
| FMDB1000 | 18627167 | NA | NA | PVAPLQRSGPE | PVAPLQRSGPE | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | NA | 1149.6142 | 0.54 mg/mL |
| FMDB1001 | 18627167 | NA | NA | PRSGNVGESGL | PRSGNVGESGL | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1149.687 | NA | 0.54 mg/mL |
| FMDB1002 | 18627167 | NA | NA | VAPSRPTPR | VAPSRPTPR | 9 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1084.5474 | NA | 0.54 mg/mL |
| FMDB1003 | 18627167 | NA | NA | DIIIPD | DIIIPD | 6 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1162.6822 | NA | 0.54 mg/mL |
| FMDB1004 | 18627167 | NA | NA | PRSGNVGESGLID | PRSGNVGESGLID | 13 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1299.6419 | NA | 0.45 mg/mL |
| FMDB1005 | 18627167 | NA | NA | DPVAPLQRSGPEI | DPVAPLQRSGPEI | 13 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1149.6142 | NA | 0.45 mg/mL |
| FMDB1006 | 18627167 | NA | NA | DPVAPLQRSGPEIP | DPVAPLQRSGPEIP | 14 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1262.6983 | NA | 0.45 mg/mL |
| FMDB1007 | 18627167 | NA | NA | PVAPLPRKGS | PVAPLPRKGS | 10 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1020.608 | NA | 0.45 mg/mL |
| FMDB1008 | 18627167 | NA | NA | DPVAPLQRSGPE | DPVAPLQRSGPE | 12 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1020.5716 | NA | 0.45 mg/mL |
| FMDB1009 | 18627167 | NA | NA | SFTAGARTFNFDENPCDYFQGGKIKAT | SFTAGARTFNFDENPCDYFQGGKIKAT | 27 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 2984.3763 | NA | 0.45 mg/mL |