| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2867 | YRDRFAFQPH | Peptide 7 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2868 | IWRYSLASQQ | Peptide 8 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2869 | YQKQAKIMCS | Peptide 9 | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2870 | VQLRRRWC | Peptide 10 | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2871 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2872 | NTGTWLKYHS | Peptide 1-C3G | 10 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2873 | TCTWLKYHS | Peptide 1-NΔ | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2874 | NTCTWLKYH | Peptide 1-SΔ | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2875 | TCTWLKYH | Peptide 1-NSΔ | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2876 | CTWLKYH | Peptide 1-NTSΔ | 7 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2877 | TWLKYH | Peptide 1-NTCSΔ | 6 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2878 | CTWLKY | Peptide 1-NTHSΔ | 6 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 25562654 |
| 2886 | VKRFKKFFRKLKKSV | B1 | 15 | L | Linear | Synthetic | NA | Free | Amidation | NA | Fluorophore (FITC) | 25462264 |
| 2887 | VKRFKKFFRKLKKLV | B1-Leu | 15 | L | Linear | Synthetic | NA | Free | Amidation | NA | Fluorophore (FITC) | 25462264 |
| 2888 | VKRFKKFFRKLKKKV | B1-Lys | 15 | L | Linear | Synthetic | NA | Free | Amidation | NA | Fluorophore (FITC) | 25462264 |
| 2898 | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK | PACAP | 38 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Fluorophore (Fluorescien) | 25447531 |
| 2899 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
| 2900 | rqikiwfqnrrmkwkk | D-Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 25445695 |
| 2901 | MAARLCCQLDPARDVLCLRP | N-terminus of X-Pep | 20 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2902 | MAARLCCQLDPARDV | N-terminus of X-Pep | 15 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2903 | MAARLCCQ | X-Pep | 8 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2904 | MAARL | X-Pep derivative | 5 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25251474 |
| 2905 | YGRKKRRQRRR | TAT (47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Quantum dots) | 25570933 |
| 2906 | YGRKKRRQRRRGLFGAIAGFIENGWEGMIDGWYG | TAT-HA2 | 34 | L | Linear | Synthetic | NA | Free | Free | NA | Nanoparticle (Quantum dots) | 25570933 |
| 2907 | RRLSYSRRRF | SynB3 | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (Endomorphin-1) | 25245547 |
| 2908 | RHHRRHHRRHRRHHRRHHRHHR | B6 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2909 | HHHRRRRRRRRRHHH | D8 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2910 | HHHHHHRRRRRRRRR | D9 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2911 | RRRRRRRRR | F7 | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2912 | RHHLRHLRRHLRHLLRHLRHHLRHLRRHLRHLL | A1 | 33 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2913 | RLHHRLHRRLHRLHRRLHRLHHRLHRRLH | A2 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2914 | LRHLLRHLLRHLRHLLRHLRHLLRHLLRH | A3 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2915 | LRHHLRHLLRHLRHLLRHLRHHLRHLLRH | A4 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2916 | RLHRRLHRRLHRLHRRLHRLHRRLHRRLH | A5 | 29 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2917 | RHHLRHLRRHLRHLLRHLRHHL | B5 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2918 | LHHLLHHLLHLLHHLLHHLHHL | B8 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2919 | RRHLRRHLRHLRRHLRRHLRHL | B9 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2920 | RLHLRLHLRHLRHHLRLH | C4 | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2921 | RLHHRLHRRLHRLHR | D11 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2922 | LRHLLRHLLRHLRHL | D12 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2923 | RLHRRLHRRLHRLHR | E2 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2924 | RHHLRHLRRHL | F3 | 11 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2925 | AEAEAEAEAKAKAKAKAGGGHRRRRRRR | A9 | 28 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2926 | RFTFHFRFEFTFHFEGGGRRRRRRR | A10 | 25 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2927 | FQFNFQFNGGGHRRRRRRR | C1 | 19 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2928 | AEAEAEAEAKAKAKAK | C11 | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2929 | RFTFHFRFEFTFHFE | E3 | 15 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2930 | RHNFRFFFNFRTNR | E7 | 14 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2931 | NRHFRFFFNFTNR | E8 | 13 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
| 2932 | FTFHFTFHF | F8 | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |