CancerPPD 2.0 - Year of Publication

Browsing Year-wise

Browse Results:

Filter by Length
Minimum Length
Maximum Length

ID	PMID	YEAR	Sequence	Name	Length	Linear/Cyclic	Chirality	Chem-MOD	C-ter MOD	N-ter MOD	Nature	Origin	Cell Line	Cancer Type	Assay	Activity	Testing Time	Tissue Affected	Patents
4618	20964334	2010	KWKWKW	Dex-(KW)3	6	Linear	L	Dextran	Amidation	Dextran	Anticancer	Synthetic	PC-3	Prostate Cancer	MTT/MTS assay	at 10 µM 60% viablity	Not Available	Prostate	None
4619	20964334	2010	KWKWKW	Dex-(KW)3	6	Linear	L	Dextran	Amidation	Dextran	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT/MTS assay	at 10 µM 35-40% viablity	Not Available	Breast	None
4616	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	Skmel-25	Skin Cancer	MTT/MTS assay	at 100 µM 55^-60% viablity	48-h	Skin	None
4617	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	Skmel-28	Skin Cancer	MTT/MTS assay	at 100 µM 35-40% viablity	48-h	Skin	None
4614	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	B16F10-Nex 2	Skin Cancer	MTT/MTS assay	at 100 µM 50% viablity	48-h	Skin	None
4615	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	A-2058	Skin Cancer	MTT/MTS assay	at 100 µM 30% viablity	48-h	Skin	None
4612	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	MDA-MB-231	Breast Cancer	MTT/MTS assay	at 100 µM 55% viablity	48-h	Breast	None
4613	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	at 100 µM 50% viablity	48-h	Cervix	None
4611	20802991	2010	CSSRTMHHC	Peptide-20	9	Cyclic(C1-C9)	L	None	Free	Free	Antitumor	Synthetic Peptide	HL-60	Leukemia Cancer	MTT/MTS assay	at 100 µM 90% viablity	48-h	Blood	None
4454	17067680, 18957441	2007	GIKCRFCCGCCTPGICGVCCRF	hepcidin TH1-5	22	Not Available	L	None	Free	Free	Anticancer	Tilapia, Oreochromis mossambicus	Not Available	Colorectal Cancer	Not Available	Not Available	Not Available	Not Available	None
4453	17561225, 18957441	2007	LLGMIPLAISAISALSKL	Phylloseptin-L1	32	Not Available	L	None	Free	Free	Anticancer	Hylomantis lemur (Hylidae: Phyllomedusinae	Not Available	Colorectal Cancer	Not Available	Not Available	Not Available	Not Available	None
4452	17561225, 18957441	2007	GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS	Phylloseptin	32	Not Available	L	None	Free	Free	Anticancer	Hylomantis lemur (Hylidae: Phyllomedusinae	Not Available	Colorectal Cancer	Not Available	Not Available	Not Available	Not Available	None
4439	19341344, 18957441	2009	ILPILSLIGGLLGK	Temporin-1CEb	17	Not Available	L	None	Free	Free	Antimicrobial	Rana chensinensis, China, Asia	Not Available	Breast Cancer	Not Available	Not Available	Not Available	Not Available	None
4423	18191970, 18957441	2008	GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN	Vibi H	31	Not Available	L	None	Free	Free	Anticancer	Alpine violetViola biflora	Not Available	Lung Cancer	Not Available	Not Available	Not Available	Not Available	None
4422	18191970, 18957441	2008	GIPCAESCVWIPCTVTALIGCGCSNKVCYN	Vibi E	30	Not Available	L	None	Free	Free	Anticancer	Alpine violetViola biflora	Not Available	Leukemia Cancer	Not Available	Not Available	Not Available	Not Available	None
4418	18191970, 18957441	2008	GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN	Vibi G	31	Not Available	L	None	Free	Free	Anticancer	Alpine violetViola biflora	Not Available	Skin Cancer	Not Available	Not Available	Not Available	Not Available	None
4403	20198492, 18957441	2010	GKWMSLLKHILK	Halictine 2	12	Not Available	L	None	Free	Free	Anticancer	Venom, the eusocial bee, Halictus sexcinctus	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4402	20198492, 18957441	2010	GMWSKILGHLIR	Halictine 1	12	Not Available	L	None	Free	Free	Anticancer	venom, the eusocial bee, Halictus sexcinctus	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4397	20575512, 18957441	2010	GIACGESCVFLGCFIPGCSCKSKVCYFN	Psyle A	28	Not Available	L	None	Free	Free	Antibacterial	Psychotria leptothyrsa	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4396	20575512, 18957441	2010	GVIPCGESCVFIPCISSVLGCSCKNKVCYRD	Psyle E	31	Not Available	L	None	Free	Free	Antibacterial	Psychotria leptothyrsa	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4395	20575512, 18957441	2010	KLCGETCFKFKCYTPGCSCSYPFCK	Psyle C	25	Not Available	L	None	Free	Free	Antibacterial	Psychotria leptothyrsa	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4364	16713189, 18957441	2006	FLPILASLAAKFGPKLFCLVTKKC	Brevinin-1BYa	24	Not Available	L	None	Free	Free	Antibacterial	Rana boylii, North America	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4362	19254736, 18957441	2009	GLMDTIKGVAKTVAASWLDKLKCKITGC	Ranatuerin-2Ya	28	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates yavapaiensis	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4361	19254736, 18957441	2009	FLPVIAGVAANFLPKLFCAISKKC	Brevinin-1BLa	24	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates blairi	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4360	19254736, 18957441	2009	FLPIIAGVAAKVLPKIFCAISKKC	Brevinin-1BLa	24	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates blairi	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4359	19254736, 18957441	2009	FLPIIAGIAAKFLPKIFCTISKKC	Brevinin-1BLa	24	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates blairi	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4358	19254736, 18957441	2009	FLPIIAGAAAKVVQKIFCAISKKC	Brevinin-1BLa	24	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates blairi	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4357	19254736, 18957441	2009	FLPIIAGAAAKVVEKIFCAISKKC	Brevinin-1BLa	24	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates blairi	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4356	19254736, 18957441	2009	FLPAIVGAAAKFLPKIFCAISKKC	Brevinin-1BLa	24	Not Available	L	None	Free	Free	Antibacterial	North America, leopard frog, Lithobates blairi	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4355	17698251, 18957441	2007	FLIGMTQGLICLITRKC	Dybowskin-2	17	Not Available	L	None	Free	Free	Antibacterial	Rana dybowskii, Rana chensinensis, Asia	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4354	None	2009	GRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa371-377) -nLytic	24	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 8.0 µM	48-h	Pancreatic	WO_2010_064207_A2
4353	None	2009	GRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa371-377) -nLytic	24	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	Pane- 1	Breast Cancer	WST-1 assay	IC₅₀= 14.1 µM	48-h	Breast	WO_2010_064207_A2
4352	None	2009	GRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa371-377) -nLytic	24	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	CFPAC-I	Pancreatic Cancer	WST-1 assay	IC₅₀= 9.2 µM	48-h	Pancreatic	WO_2010_064207_A2
4351	None	2009	GRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa371-377) -nLytic	24	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 14.7 µM	48-h	Pancreatic	WO_2010_064207_A2
4350	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 7.9 µM	48-h	Pancreatic	WO_2010_064207_A2
4349	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	Pane- 1	Breast Cancer	WST-1 assay	IC₅₀= 13.1 µM	48-h	Breast	WO_2010_064207_A2
4348	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	CFPAC-I	Pancreatic Cancer	WST-1 assay	IC₅₀= 10.6 µM	48-h	Pancreatic	WO_2010_064207_A2
4347	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 12.5 µM	48-h	Pancreatic	WO_2010_064207_A2
4346	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	LNCaP	Prostate Cancer	WST-1 assay	IC₅₀= 4.8 µM	Not Available	Prostate	US_8436137_B2
4345	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 7.4 µM	Not Available	Pancreatic	US_8436137_B2
4344	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 6.6 µM	Not Available	Pancreatic	US_8436137_B2
4343	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	U-251	Brain Tumor	WST-1 assay	IC₅₀= 8.4 µM	Not Available	Brain	US_8436137_B2
4342	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BT-20	Breast Cancer	WST-1 assay	IC₅₀= 1.9 µM	Not Available	Breast	US_8436137_B2
4341	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	H-322	Lung Cancer	WST-1 assay	IC₅₀= 3.2 µM	Not Available	Lung	US_8436137_B2
4340	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	LNCaP	Prostate Cancer	WST-1 assay	IC₅₀= 10 µM	Not Available	Prostate	US_8436137_B2
4339	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 12 µM	Not Available	Pancreatic	US_8436137_B2
4338	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 12 µM	Not Available	Pancreatic	US_8436137_B2
4337	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	U-251	Brain Tumor	WST-1 assay	IC₅₀= 12 µM	Not Available	Brain	US_8436137_B2
4336	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BT-20	Breast Cancer	WST-1 assay	IC₅₀= 6.5 µM	Not Available	Breast	US_8436137_B2
4335	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	H-322	Lung Cancer	WST-1 assay	IC₅₀= 6.8 µM	Not Available	Lung	US_8436137_B2
4262	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	2% apoptosis at 50 µM	8-h	Not Available	None
4261	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	1% apoptosis at 20 µM	8-h	Not Available	None
4260	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	0% apoptosis at 10 µM	8-h	Not Available	None
4259	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	3% apoptosis at 50 µM	8-h	Not Available	None
4258	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	2% apoptosis at 20 µM	8-h	Not Available	None
4257	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	1% apoptosis at 10 µM	8-h	Not Available	None
4256	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	5% apoptosis at 50 µM	8-h	Brain	None
4255	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	1% apoptosis at 20 µM	8-h	Brain	None
4254	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	2% apoptosis at 10 µM	8-h	Brain	None
4253	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	3% apoptosis at 50 µM	8-h	Brain	None
4252	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	2% apoptosis at 20 µM	8-h	Brain	None
4251	16568093	2006	rrrrrrrrGEDIIRNIARHAAQVGASMDR	r8-BidBH3Alt	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	1% apoptosis at 10 µM	8-h	Brain	None
4250	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	55% apoptosis at 50 µM	8-h	Not Available	None
4249	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	35% apoptosis at 20 µM	8-h	Not Available	None
4248	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	23% apoptosis at 10 µM	8-h	Not Available	None
4247	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	79% apoptosis at 50 µM	8-h	Not Available	None
4246	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	46% apoptosis at 20 µM	8-h	Not Available	None
4245	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	43% apoptosis at 10 µM	8-h	Not Available	None
4244	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	68% apoptosis at 50 µM	8-h	Brain	None
4243	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	66% apoptosis at 20 µM	8-h	Brain	None
4242	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	25% apoptosis at 10 µM	8-h	Brain	None
4241	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	65% apoptosis at 50 µM	8-h	Brain	None
4240	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	45% apoptosis at 20 µM	8-h	Brain	None
4239	16568093	2006	rrrrrrrrGEDIIRNIARHLAQVGDSMDR	r8-BidBH3	29	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	8% apoptosis at 10 µM	8-h	Brain	None
4238	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	50% apoptosis at 50 µM	8-h	Not Available	None
4237	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	20% apoptosis at 20 µM	8-h	Not Available	None
4236	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	15% apoptosis at 10 µM	8-h	Not Available	None
4235	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	30% apoptosis at 50 µM	8-h	Not Available	None
4234	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	>50% apoptosis at 20 µM	8-h	Not Available	None
4233	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	20% apoptosis at 10 µM	8-h	Not Available	None
4232	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	80% apoptosis at 50 µM	8-h	Brain	None
4231	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	80% apoptosis at 20 µM	8-h	Brain	None
4230	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	30% apoptosis at 10 µM	8-h	Brain	None
4229	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	30% apoptosis at 50 µM	8-h	Brain	None
4228	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	10% apoptosis at 20 µM	8-h	Brain	None
4227	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	0% apoptosis at 10 µM	8-h	Brain	None
4025	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	47.0% inhibition at 10^-3M	31.92-Min	Colon	None
4026	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	2.2% inhibition at 10^-6M	31.92-Min	Breast	None
4027	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	7.1% inhibition at 10^-5M	31.92-Min	Breast	None
4028	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	6.9% inhibition at 10^-4M	31.92-Min	Breast	None
4029	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	25.9% inhibition at 10^-3M	31.92-Min	Breast	None
4021	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	70.7% inhibition at 10^-5M	31.92-Min	Skin	None
4022	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	34.4% inhibition at 10^-3M	31.92-Min	Skin	None
4023	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	9.2% inhibition at 10^-3M	31.92-Min	Colon	None
4024	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	11.08% inhibition at 10^-5M	31.92-Min	Colon	None
4016	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	29.9% inhibition at 10^-3M	23.03-Min	Breast	None
4017	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	3.9% inhibition at 10^-5M	31.92-Min	Larynx	None
4018	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	45% inhibition at 10^-3M	31.92-Min	Larynx	None
4019	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	9.3% inhibition at 10^-3M	31.92-Min	Cervix	None
4020	16722632	2006	YGGFMA*	23	6	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	4.1% inhibition at 10^-6M	31.92-Min	Skin	None
4012	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	10.9% inhibition at 10^-5M	23.03-Min	Colon	None
4013	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	12.1% inhibition at 10^-4M	23.03-Min	Colon	None
4014	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	8.1% inhibition at 10^-3M	23.03-Min	Colon	None
4015	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	9.6% inhibition at 10^-4M	23.03-Min	Breast	None
4008	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	13.1% inhibition at 10^-5M	23.03-Min	Colon	None
4009	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	14.6% inhibition at 10^-4M	23.03-Min	Colon	None
4010	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	38.4% inhibition at 10^-3M	23.03-Min	Colon	None
4011	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	17.7% inhibition at 10^-6M	23.03-Min	Colon	None
4003	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	16.2% inhibition at 10^-6M	23.03-Min	Colon	None
4004	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	6.6% inhibition at 10^-5M	23.03-Min	Colon	None
4005	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	5.1% inhibition at 10^-4M	23.03-Min	Colon	None
4006	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	14.5% inhibition at 10^-3M	23.03-Min	Colon	None
4007	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	26.4% inhibition at 10^-6M	23.03-Min	Colon	None
3999	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	2.4% inhibition at 10^-6M	23.03-Min	Skin	None
4000	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	4.5% inhibition at 10^-5M	23.03-Min	Skin	None
4001	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	11.4% inhibition at 10^-4M	23.03-Min	Skin	None
4002	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	23.2% inhibition at 10^-3M	23.03-Min	Skin	None
3994	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	44.5% inhibition at 10^-3M	23.03-Min	Larynx	None
3995	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	8.5% inhibition at 10^-6M	23.03-Min	Cervix	None
3996	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	9.5% inhibition at 10^-5M	23.03-Min	Cervix	None
3997	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	15.4% inhibition at 10^-4M	23.03-Min	Cervix	None
3998	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	24.1% inhibition at 10^-3M	23.03-Min	Cervix	None
3991	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	13.7% inhibition at 10^-6M	23.03-Min	Larynx	None
3992	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	25.8% inhibition at 10^-5M	23.03-Min	Larynx	None
3993	16722632	2006	YA*GFM	18	5	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	34.7% inhibition at 10^-4M	23.03-Min	Larynx	None
3988	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	18.5% inhibition at 10^-4M	26.70-Min	Colon	None
3989	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	10.6% inhibition at 10^-3M	26.70-Min	Colon	None
3990	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	22.8% inhibition at 10^-3M	26.70-Min	Breast	None
3986	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	3.0% inhibition at 10^-6M	26.70-Min	Colon	None
3987	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	8.4% inhibition at 10^-5M	26.70-Min	Colon	None
3984	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	24.7% inhibition at 10^-4M	26.70-Min	Colon	None
3985	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	29.0% inhibition at 10^-3M	26.70-Min	Colon	None
3981	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	23.7% inhibition at 10^-3M	26.70-Min	Colon	None
3982	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	12.2% inhibition at 10^-6M	26.70-Min	Colon	None
3983	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	15.5% inhibition at 10^-5M	26.70-Min	Colon	None
3978	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	3.3% inhibition at 10^-6M	26.70-Min	Colon	None
3979	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	11.0% inhibition at 10^-5M	26.70-Min	Colon	None
3980	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	7.9% inhibition at 10^-4M	26.70-Min	Colon	None
3976	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	2.4% inhibition at 10^-4M	26.70-Min	Skin	None
3977	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	18.3% inhibition at 10^-3M	26.70-Min	Skin	None
3971	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	10.2% inhibition at 10^-5M	26.70-Min	Cervix	None
3972	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	13.3% inhibition at 10^-4M	26.70-Min	Cervix	None
3973	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	28.0% inhibition at 10^-3M	26.70-Min	Cervix	None
3974	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	0.8% inhibition at 10^-6M	26.70-Min	Skin	None
3975	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	1.4% inhibition at 10^-5M	26.70-Min	Skin	None
3970	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	4.9% inhibition at 10^-6M	26.70-Min	Cervix	None
3969	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	36.1% inhibition at 10^-3M	26.70-Min	Larynx	None
3968	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	16.8% inhibition at 10^-4M	26.70-Min	Larynx	None
3967	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	10.1% inhibition at 10^-5M	26.70-Min	Larynx	None
3966	16722632	2006	YA*GFM	17	5	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	1.0% inhibition at 10^-6M	26.70-Min	Larynx	None
3964	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	8.6% inhibition at 10^-3M	10.79-Min	Colon	None
3965	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	15.6% inhibition at 10^-3M	10.79-Min	Breast	None
3962	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	6.9% inhibition at 10^-5M	10.79-Min	Colon	None
3963	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	8.1% inhibition at 10^-4M	10.79-Min	Colon	None
3959	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	13.5% inhibition at 10^-4M	10.79-Min	Colon	None
3960	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	25.3% inhibition at 10^-3M	10.79-Min	Colon	None
3961	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	8.1% inhibition at 10^-6M	10.79-Min	Colon	None
3957	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	17.0% inhibition at 10^-6M	10.79-Min	Colon	None
3958	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	13.5% inhibition at 10^-5M	10.79-Min	Colon	None
3955	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	12.4% inhibition at 10^-4M	10.79-Min	Colon	None
3956	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	22.4% inhibition at 10^-3M	10.79-Min	Colon	None
3952	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	19.4% inhibition at 10^-3M	10.79-Min	Skin	None
3953	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	7.6% inhibition at 10^-6M	10.79-Min	Colon	None
3954	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	3.8% inhibition at 10^-5M	10.79-Min	Colon	None
3949	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	28.2% inhibition at 10^-3M	10.79-Min	Cervix	None
3950	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	1.2% inhibition at 10^-5M	10.79-Min	Skin	None
3951	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	3.3% inhibition at 10^-4M	10.79-Min	Skin	None
3947	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	11.7% inhibition at 10^-5M	10.79-Min	Cervix	None
3948	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	11.6% inhibition at 10^-4M	10.79-Min	Cervix	None
3944	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	12.6% inhibition at 10^-4M	10.79-Min	Larynx	None
3945	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	26.4% inhibition at 10^-3M	10.79-Min	Larynx	None
3946	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	11.0% inhibition at 10^-6M	10.79-Min	Cervix	None
3942	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	4.6% inhibition at 10^-6M	10.79-Min	Larynx	None
3943	16722632	2006	YRA*G	16	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	4.9% inhibition at 10^-5M	10.79-Min	Larynx	None
3940	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	6.2% inhibition at 10^-3M	9.53-Min	Colon	None
3941	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	21.2% inhibition at 10^-3M	9.53-Min	Breast	None
3937	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	2.2% inhibition at 10^-6M	9.53-Min	Colon	None
3938	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	4.2% inhibition at 10^-5M	9.53-Min	Colon	None
3939	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	6.4% inhibition at 10^-4M	9.53-Min	Colon	None
3935	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	14.4% inhibition at 10^-4M	9.53-Min	Colon	None
3936	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	23.4% inhibition at 10^-3M	9.53-Min	Colon	None
3932	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	15.7% inhibition at 10^-3M	9.53-Min	Colon	None
3933	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	13.6% inhibition at 10^-6M	9.53-Min	Colon	None
3934	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	20.4% inhibition at 10^-5M	9.53-Min	Colon	None
3930	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	7.4% inhibition at 10^-5M	9.53-Min	Colon	None
3931	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	9.5% inhibition at 10^-4M	9.53-Min	Colon	None
3927	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	5.9% inhibition at 10^-4M	9.53-Min	Skin	None
3928	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	17.9% inhibition at 10^-3M	9.53-Min	Skin	None
3929	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	5.4% inhibition at 10^-6M	9.53-Min	Colon	None
3925	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	1.6% inhibition at 10^-6M	9.53-Min	Skin	None
3926	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	2.9% inhibition at 10^-5M	9.53-Min	Skin	None
3922	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	7.3% inhibition at 10^-5M	9.53-Min	Cervix	None
3923	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	9.9% inhibition at 10^-4M	9.53-Min	Cervix	None
3924	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	28.2% inhibition at 10^-3M	9.53-Min	Cervix	None
3920	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	26.7% inhibition at 10^-3M	9.53-Min	Larynx	None
3921	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	9.8% inhibition at 10^-6M	9.53-Min	Cervix	None
3917	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	2.7% inhibition at 10^-6M	9.53-Min	Larynx	None
3918	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	2.0% inhibition at 10^-5M	9.53-Min	Larynx	None
3919	16722632	2006	YSA*G	15	4	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	18.8% inhibition at 10^-4M	9.53-Min	Larynx	None
3915	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	7.7% inhibition at 10^-4M	14.05-Min	Breast	None
3916	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	18.7% inhibition at 10^-3M	14.05-Min	Breast	None
3913	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	10.7% inhibition at 10^-6	14.05-Min	Colon	None
3914	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	10.0% inhibition at 10^-5	14.05-Min	Colon	None
3910	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	8.3% inhibition at 10^-5	14.05-Min	Colon	None
3911	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	10.5% inhibition at 10^-4	14.05-Min	Colon	None
3912	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	21.8% inhibition at 10^-3	14.05-Min	Colon	None
3908	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	7.3% inhibition at 10^-3	14.05-Min	Skin	None
3909	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	0.7% inhibition at 10^-6	14.05-Min	Colon	None
3905	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	3.0% inhibition at 10^-6	14.05-Min	Skin	None
3906	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	4.7% inhibition at 10^-5	14.05-Min	Skin	None
3907	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	2.7% inhibition at 10^-4	14.05-Min	Skin	None
3903	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	11.0% inhibition at 10^-4	14.05-Min	Cervix	None
3904	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	20.5% inhibition at 10^-3	14.05-Min	Cervix	None
3901	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	7.2% inhibition at 10^-6	14.05-Min	Cervix	None
3902	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	17.1% inhibition at 10^-5	14.05-Min	Cervix	None
3898	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	4.9% inhibition at 10^-5	14.05-Min	Larynx	None
3899	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	1.9% inhibition at 10^-4	14.05-Min	Larynx	None
3900	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	16.2% inhibition at 10^-3	14.05-Min	Larynx	None
3896	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	17.8% inhibition at 10^-3	12.46-Min	Breast	None
3897	16722632	2006	YSA*	10	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	8.5% inhibition at 10^-6	14.05-Min	Larynx	None
3893	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	14.5% inhibition at 10^-3	12.46-Min	Colon	None
3894	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	1.1% inhibition at 10^-5	12.46-Min	Breast	None
3895	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	1.2% inhibition at 10^-4	12.46-Min	Breast	None
3892	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	8.4% inhibition at 10^-4	12.46-Min	Colon	None
3891	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	16.5% inhibition at 10^-5	12.46-Min	Colon	None
3890	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	3.7% inhibition at 10^-6	12.46-Min	Colon	None
3889	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	17.9% inhibition at 10^-3	12.46-Min	Colon	None
3888	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	11.8% inhibition at 10^-4	12.46-Min	Colon	None
3887	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	21.9% inhibition at 10^-5	12.46-Min	Colon	None
3886	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	10.5% inhibition at 10^-6	12.46-Min	Colon	None
3885	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	20.8% inhibition at 10^-3	12.46-Min	Colon	None
3884	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	3.4% inhibition at 10^-4	12.46-Min	Colon	None
3883	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	8.9% inhibition at 10^-5	12.46-Min	Colon	None
3882	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	4.9% inhibition at 10^-6	12.46-Min	Colon	None
3881	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	7.3% inhibition at 10^-3	12.46-Min	Skin	None
3880	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	3.9% inhibition at 10^-5	12.46-Min	Skin	None
3879	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	14.8% inhibition at 10^-3	12.46-Min	Cervix	None
3877	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	6.1% inhibition at 10^-5	12.46-Min	Cervix	None
3878	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	3.1% inhibition at 10^-4	12.46-Min	Cervix	None
3876	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	7.5% inhibition at 10^-6	12.46-Min	Cervix	None
3875	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	21.2% inhibition at 10^-3	12.46-Min	Larynx	None
3874	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	8.2% inhibition at 10^-4	12.46-Min	Larynx	None
3873	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	6.4% inhibition at 10^-5	12.46-Min	Larynx	None
3872	16722632	2006	YSA*	9	3	Linear	L	A* = Cα -dialkylated glycine (Aaa2,2 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	6.2% inhibition at 10^-6	12.46-Min	Larynx	None
3871	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	7.5% inhibition at 10^-4	12.81-Min	Breast	None
3870	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	MCF-7	Breast Cancer	MTT/MTS assay	2.4% inhibition at 10^-5	12.81-Min	Breast	None
3868	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	18.9% inhibition at 10^-4	12.81-Min	Colon	None
3869	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	26.4% inhibition at 10^-3	12.81-Min	Colon	None
3867	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	22.7% inhibition at 10^-5	12.81-Min	Colon	None
3866	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	CaCo-2	Colon Cancer	MTT/MTS assay	3.5% inhibition at 10^-6	12.81-Min	Colon	None
3864	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	28.1% inhibition at 10^-4	12.81-Min	Colon	None
3865	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	58.2% inhibition at 10^-3	12.81-Min	Colon	None
3863	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	16.5% inhibition at 10^-5	12.81-Min	Colon	None
3862	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	SW-620	Colon Cancer	MTT/MTS assay	12.9% inhibition at 10^-6	12.81-Min	Colon	None
3861	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	26.5% inhibition at 10^-3	12.81-Min	Colon	None
3859	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	1.6% inhibition at 10^-5	12.81-Min	Colon	None
3860	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	5.4% inhibition at 10^-4	12.81-Min	Colon	None
3857	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	14% inhibition at 10^-3	12.81-Min	Skin	None
3858	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HT-29	Colon Cancer	MTT/MTS assay	9.8% inhibition at 10^-6	12.81-Min	Colon	None
3856	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	7.5% inhibition at 10^-4	12.81-Min	Skin	None
3855	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	14% inhibition at 10^-5	12.81-Min	Skin	None
3854	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HBL	Skin Cancer	MTT/MTS assay	6.5% inhibition at 10^-6	12.81-Min	Skin	None
3853	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	36.1% inhibition at 10^-3	12.81-Min	Not Available	None
3852	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	8.2% inhibition at 10^-4	12.81-Min	Not Available	None
3851	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HeLa	Cervical Cancer	MTT/MTS assay	10% inhibition at 10^-5	12.81-Min	Not Available	None
3850	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	30.4% inhibition at 10^-3	12.81-Min	Not Available	None
3849	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	24.9% inhibition at 10^-4	12.81-Min	Not Available	None
3848	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	19.7% inhibition at 10^-5	12.81-Min	Not Available	None
3847	16722632	2006	YA*	8	2	Linear	L	A* = Cαα -dialkylated glycine (Aaa1,1 )	Free	Free	Antitumor	Synthetic Peptide	HEp-2	Larynx Cancer	MTT/MTS assay	14.2% inhibition at 10^-6	12.81-Min	Not Available	None
3842	20515045	2010	ACDCRGDCFCGGGGIVRRADRAAVP	AP(O)	25	Cyclic(C2-C10,C	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	52% inhibition at 10µg/ml	NA	Not Available	None
3841	20515045	2010	ACDCRGDCFCGGGGIVRRADRAAVP	AP(O)	25	Cyclic(C2-C10,C	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	42% inhibition at 5µg/ml	NA	Not Available	None
3840	20515045	2010	ACDCRGDCFCGGGGIVRRADRAAVP	AP(O)	25	Cyclic(C2-C10,C	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	40% inhibition at 2.5µg/ml	NA	Not Available	None
3839	20515045	2010	ACDCRGDCFCGGGGIVRRADRAAVP	AP	25	Linear	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	75% inhibition at 10µg/ml	NA	Not Available	None
3838	20515045	2010	ACDCRGDCFCGGGGIVRRADRAAVP	AP	25	Linear	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	40% inhibition at 5µg/ml	NA	Not Available	None
3837	20515045	2010	ACDCRGDCFCGGGGIVRRADRAAVP	AP	25	Linear	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	50% inhibition at 2.5µg/ml	NA	Not Available	None
3836	20515045	2010	IVRRADRAAVP	ES-2	11	Linear	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	60% inhibition at 10µg/ml	NA	Not Available	None
3835	20515045	2010	IVRRADRAAVP	ES-2	11	Linear	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	60% inhibition at 5µg/ml	NA	Not Available	None
3834	20515045	2010	IVRRADRAAVP	ES-2	11	Linear	L	None	Free	Free	Antitumor	Endostatin derived synthetic peptide	BAE	Tumor	MTT/MTS assay	60% inhibition at 2.5µg/ml	NA	Not Available	None
3299	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	A-375	Skin Cancer	MTT/MTS assay	6.5 ± 1.07% cell viability at 80 µM	NA	Skin	None
3298	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	A-375	Skin Cancer	MTT/MTS assay	26.9 ± 0.5% cell viability at 60 µM	NA	Skin	None
3297	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	A-375	Skin Cancer	MTT/MTS assay	47.5 ± 1.66% cell viability at 40 µM	NA	Skin	None
3296	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	A-375	Skin Cancer	MTT/MTS assay	63.8 ± 0.8% cell viability at 20 µM	NA	Skin	None
3295	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	A-375	Skin Cancer	MTT/MTS assay	86 ± 0.57% cell viability at 10 µM	NA	Skin	None
3294	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	M14	Skin Cancer	MTT/MTS assay	13.8 ± 1.44% cell viability at 80 µM	NA	Skin	None
3293	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	M14	Skin Cancer	MTT/MTS assay	31.5 ± 1.49% cell viability at 60 µM	NA	Skin	None
3292	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	M14	Skin Cancer	MTT/MTS assay	50 ± 3.09% cell viability at 40 µM	NA	Skin	None
3291	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Synthetic peptide	M14	Skin Cancer	MTT/MTS assay	71.1 ± 2.84% cell viability at 20 µM	NA	Skin	None
3290	19957017	2010	KWKLFKKIPKFLHLAKKF	P18	18	Linear	L	None	Free	Free	Antibacterial	Bovine lactoferrin (Lf-B)	M14	Skin Cancer	MTT/MTS assay	92.2 ± 1.02% cell viability at 10 µM	NA	Skin	None
3289	19527490	2009	KAAKKAAKAAKKAAKAAKKAA	KW5	21	Linear	L	None	Free	Free	Anticancer	Synthetic peptide	HT-29	Colon Cancer	MTT/MTS assay	IC₅₀ =55±14 µM	NA	Colon	None
3288	19527490	2009	KAAKKAAKAAKKAAKAAKKAA	KW5	21	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	FEMX	Skin Cancer	MTT/MTS assay	IC₅₀ =30±3 µM	NA	Skin	None
3287	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	Ramos	Lymphoma Cancer	MTT/MTS assay	IC₅₀ = 10 µM	NA	Blood	None
3286	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	Raji	Lymphoma Cancer	MTT/MTS assay	IC₅₀ = 13 µM	NA	Blood	None
3285	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	Sudhl-4	Skin Cancer	MTT/MTS assay	IC₅₀ = 16 µM	NA	Skin	None
3284	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	KMM-1	Skin Cancer	MTT/MTS assay	IC₅₀ = 57 µM	NA	Skin	None
3283	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	U-266	Lymphoma Cancer	MTT/MTS assay	IC₅₀ = 55 µM	NA	Blood	None
3282	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	KMS-5	Skin Cancer	MTT/MTS assay	IC₅₀ = 38 µM	NA	Skin	None
3281	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	HT-29	Colon Cancer	MTT/MTS assay	IC₅₀ =148±8 µM	NA	Colon	None
3280	19527490, 23533710	2009	FKCRRWQWRMKK	LfcinB	12	Linear	L	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	FEMX	Skin Cancer	MTT/MTS assay	IC₅₀ =40±7 µM	NA	Skin	None
3278	18815734	2008	KKKFPWWWPFKKKKKKFPWWWPFKKKK	di-PST13-RK-K	27	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	MDA-MB-361	Breast Cancer	MTT/MTS assay	IC₅₀ =10 µg/ml	NA	Breast	None
3277	18815734	2008	KKKFPWWWPFKKKKKKFPWWWPFKKKK	di-PST13-RK-K	27	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	A-549	Lung Cancer	MTT/MTS assay	IC₅₀ =15 µg/ml	NA	Lung	None
3275	18815734	2008	KKKFPWWWPFKKKCKKKFPWWWPFKKKC	di-PST13-RK-C	28	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	MDA-MB-361	Breast Cancer	MTT/MTS assay	IC₅₀ =17 µg/ml	NA	Breast	None
3274	18815734	2008	KKKFPWWWPFKKKCKKKFPWWWPFKKKC	di-PST13-RK-C	28	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	A-549	Lung Cancer	MTT/MTS assay	IC₅₀ =17 µg/ml	NA	Lung	None
3272	18815734	2008	KKKFPWWWPFKKK	PST13-RK	13	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	MDA-MB-361	Breast Cancer	MTT/MTS assay	IC₅₀ =80 µg/ml	NA	Breast	None
3271	18815734	2008	KKKFPWWWPFKKK	PST13-RK	13	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	A-549	Lung Cancer	MTT/MTS assay	IC₅₀ =90 µg/ml	NA	Lung	None
3269	18815734	2008	VRRFPWWWPFLRR	Tritrpticin	13	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	MDA-MB-361	Breast Cancer	MTT/MTS assay	IC₅₀ =142 µg/ml	NA	Breast	None
3268	18815734	2008	VRRFPWWWPFLRR	Tritrpticin	13	Linear	L	None	Amidation	Free	Antimicrobial	Derivative of tritrpticin	A-549	Lung Cancer	MTT/MTS assay	IC₅₀ >200 µg/ml	NA	Lung	None
3197	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))4	Tetramer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	MCF-7	Breast Cancer	MTT/MTS assay	IC₅₀ =0.64nM	24-h	Breast	None
3195	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))4	Tetramer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	HeLa	Cervical Cancer	MTT/MTS assay	IC₅₀ =0.96nM	24-h	Cervix	None
3196	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))4	Tetramer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	DU	Prostate Cancer	MTT/MTS assay	IC₅₀ =1.30nM	24-h	Prostate	None
3194	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))3	Trimer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	MCF-7	Breast Cancer	MTT/MTS assay	IC₅₀ =3.00nM	24-h	Breast	None
3192	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))3	Trimer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	HeLa	Cervical Cancer	MTT/MTS assay	IC₅₀ =1.70nM	24-h	Cervix	None
3193	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))3	Trimer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	DU	Prostate Cancer	MTT/MTS assay	IC₅₀ =3.88nM	24-h	Prostate	None
3191	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))4	Dimer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	MCF-7	Breast Cancer	MTT/MTS assay	IC₅₀ =0.62nM	24-h	Breast	None
3190	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))3	Dimer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	DU	Prostate Cancer	MTT/MTS assay	IC₅₀ =2.85nM	24-h	Prostate	None
3189	17787026	2007	(K-Aib-C(CH2CO-2'-Pac))2	Dimer of peptide-paclitaxel conjugate	3	Linear	L	Aib = 1-amino-isobutyric acid ,Pac = Paclitaxel	Amidation	Acetylation	Anticancer	Synthetic peptide paclitaxel conjugate	HeLa	Cervical Cancer	MTT/MTS assay	IC₅₀ =1.31nM	24-h	Cervix	None
3188	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	ED₅₀ =0.29 µM	24-h	Blood	None
3187	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	ED₅₀ >10 µM	24-h	Colon	None
3186	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	ED₅₀ =0.210 µM	24-h	Pancreatic	None
3185	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	ED₅₀ =2.1 µM	24-h	Oral mucosa	None
3184	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	94.5 % inhibition of cell proliferation at 10 µM	24-h	Blood	None
3183	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	54.3 % inhibition of cell proliferation at 1 µM	24-h	Blood	None
3182	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	34.7 % inhibition of cell proliferation at 100 nM	72-h	Blood	None
3181	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	18.7 % inhibition of cell proliferation at 10 nM	24-h	Blood	None
3180	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	10.4 % inhibition of cell proliferation at 1 nM	24-h	Blood	None
3179	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	27.9 % inhibition of cell proliferation at 10 µM	24-h	Colon	None
3178	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	21.7 % inhibition of cell proliferation at 1 µM	24-h	Colon	None
3177	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	16.8 % inhibition of cell proliferation at 100 nM	72-h	Colon	None
3176	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	14.2 % inhibition of cell proliferation at 10 nM	24-h	Colon	None
3175	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	16.5 % inhibition of cell proliferation at 1 nM	24-h	Colon	None
3174	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	84.5 % inhibition of cell proliferation at 10 µM	24-h	Pancreatic	None
3173	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	59.6 % inhibition of cell proliferation at 1 µM	24-h	Pancreatic	None
3172	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	48.2 % inhibition of cell proliferation at 100 nM	72-h	Pancreatic	None
3171	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	37.8 % inhibition of cell proliferation at 10 nM	24-h	Pancreatic	None
3170	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	24.2 % inhibition of cell proliferation at 1 nM	24-h	Pancreatic	None
3169	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	98.3 % inhibition of cell proliferation at 10 µM	24-h	Oral mucosa	None
3168	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	43.1 % inhibition of cell proliferation at 1 µM	24-h	Oral mucosa	None
3167	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	30.7 % inhibition of cell proliferation at 100 nM	72-h	Oral mucosa	None
3166	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	18.2 % inhibition of cell proliferation at 10 nM	24-h	Oral mucosa	None
3165	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	10.6 % inhibition of cell proliferation at 1 nM	24-h	Oral mucosa	None
2900	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	35.2 % Cell viability at 100 µM	72-h	Liver	None
2899	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	41.1 % Cell viability at 75 µM	72-h	Liver	None
2898	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	49.7 % Cell viability at 50 µM	72-h	Liver	None
2897	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	63.3 % Cell viability at 25 µM	72-h	Liver	None
2896	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	72.1 % Cell viability at 12.5 µM	72-h	Liver	None
2895	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	48.6 % Cell viability at 100 µM	48-h	Liver	None
2894	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	54.3 % Cell viability at 100 µM	48-h	Liver	None
2893	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	62.8 % Cell viability at 75 µM	48-h	Liver	None
2892	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	75.6 % Cell viability at 50 µM	48-h	Liver	None
2891	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	87.3 % Cell viability at 25 µM	48-h	Liver	None
2890	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	54.2 % Cell viability at 100 µM	24-h	Liver	None
2889	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	71.5 % Cell viability at 75 µM	24-h	Liver	None
2888	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	76.3% Cell viability at 50 µM	24-h	Liver	None
2887	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	84.1% Cell viability at 25 µM	24-h	Liver	None
2886	20383464	2010	MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG	Ceropin	63	Linear	L	None	Free	Free	Antimicrobial	Musca domestica	BEL-7402	Liver Cancer	Trypan blue assay	91.8% Cell viability at 12.5 µM	24-h	Liver	None
2881	20212453	2010	KWKLFKKIGAVLKVL	Camel	15	Linear	L	None	Free	Free	Antimicrobial	Ceropin-Melittin hybrid	WM1158	Skin Cancer	MTT/MTS assay	LC₅₀ = 4.1 µM	24-h	Skin	None
2880	20212453	2010	KWKLFKKIGAVLKVL	Camel	15	Linear	L	None	Free	Free	Antimicrobial	Ceropin-Melittin hybrid	4T1	Breast Cancer	MTT/MTS assay	LC₅₀ = 6.2 µM	24-h	Breast	None
2879	20212453	2010	KWKLFKKIGAVLKVL	Camel	15	Linear	L	None	Free	Free	Antimicrobial	Ceropin-Melittin hybrid	RENCA	Renal Cancer	MTT/MTS assay	LC₅₀ = 1.3 µM	24-h	Renal	None
2878	20212453	2010	KWKLFKKIGAVLKVL	Camel	15	Linear	L	None	Free	Free	Antimicrobial	Ceropin-Melittin hybrid	B16-F10	Skin Cancer	MTT/MTS assay	LC₅₀ = 1.75 µM	24-h	Skin	None
2871	16707464	2006	LKlLKKLlkKLLkLL	D-K6L9	15	Linear	Mix	None	Amidation	Free	Anticancer	Host Defense lytic Peptide	MB-231	Prostate Cancer	Enzyme Immunoassay (EIA)	LC₅₀=3 µMol/L	960-h	Prostate	None
2870	16707464	2006	LKlLKKLlkKLLkLL	D-K6L9	15	Linear	Mix	None	Amidation	Free	Anticancer	Host DefenseÐLike Lytic Peptide	CL-1	Lung Cancer	Enzyme Immunoassay (EIA)	LC₅₀=3 µMol/L	Not Available	Lung	None
2869	16707464	2006	LKlLKKLlkKLLkLL	D-K6L9	15	Linear	Mix	None	Amidation	Free	Anticancer	Host Defense lytic Peptide	22RV1	Prostate Cancer	Enzyme Immunoassay (EIA)	LC₅₀=6 µMol/L	Not Available	Prostate	None
1549	18656352	2008	KAQIRAMECNILGRKKRRQRRR	Tat-a5	22	Linear	L	None	Free	Free	Anticancer	HIV-Tat (49-57)	HCT-116	Colon Cancer	MTT/MTS assay	~80% Cytotoxicity at 100 µM	24-h	Colon	None
1547	18656352	2008	KAQIRAMECNIL	A5	12	Linear	L	None	Free	Free	Anticancer	Cyclin B (285-296)	HCT-116	Colon Cancer	MTT/MTS assay	Not Available	24-h	Colon	None
1548	18656352	2008	RKKRRQRRR	Tat	9	Linear	L	None	Free	Free	Anticancer	HIV-Tat (49-57)	HCT-116	Colon Cancer	MTT/MTS assay	~10% Cytotoxicity at 100 µM	24-h	Colon	None
1542	16637646	2006	FKRIVQRIKDFLRNLV	dLL-37(17-32)c	16	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	HBMEC	Prostate Cancer	MTT/MTS assay	Not Available	24-h	Not Available	None
1541	16637646	2006	LLGDFKRIVQRIKDF	LL-37(1-4,17-27)	15	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	HBMEC	Prostate Cancer	MTT/MTS assay	Not Available	24-h	Not Available	None
1539	16637646	2006	FKRIVQRIKDFLRNLV	LL-37(17-32)b	16	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	HBMEC	Prostate Cancer	MTT/MTS assay	LC₅₀=25 µM	24-h	Not Available	None
1540	16637646	2006	FKRIVQRIKDFLR	LL-37(17-29)	13	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	HBMEC	Prostate Cancer	MTT/MTS assay	LC₅₀=55 µM	24-h	Not Available	None
1538	16637646	2006	IGKEFKRIVQRIKDFLRNLVPRTES	LL-37(13-37)	25	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	HBMEC	Prostate Cancer	MTT/MTS assay	LC₅₀=38 µM	24-h	Not Available	None
1537	16637646	2006	LLGDFFRKSKEK	LL-37(1-12)	12	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	HBMEC	Prostate Cancer	MTT/MTS assay	Not Available	24-h	Not Available	None
1536	16637646	2006	FKRIVQRIKDFLRNLV	dLL-37(17-32)c	16	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KB	Oral Cancer	MTT/MTS assay	Not Available	24-h	Not Available	None
1534	16637646	2006	FKRIVQRIKDFLR	LL-37(17-29)	13	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KB	Oral Cancer	MTT/MTS assay	LC₅₀=57 µM	24-h	Not Available	None
1535	16637646	2006	LLGDFKRIVQRIKDF	LL-37(1-4,17-27)	15	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KB	Oral Cancer	MTT/MTS assay	Not Available	24-h	Not Available	None
1533	16637646	2006	FKRIVQRIKDFLRNLV	LL-37(17-32)b	16	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KB	Oral Cancer	MTT/MTS assay	LC₅₀=30 µM	24-h	Not Available	None
1532	16637646	2006	IGKEFKRIVQRIKDFLRNLVPRTES	LL-37(13-37)	25	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KB	Oral Cancer	MTT/MTS assay	LC₅₀=40 µM	24-h	Not Available	None
1531	16637646	2006	LLGDFFRKSKEK	LL-37(1-12)	12	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KB	Oral Cancer	MTT/MTS assay	Not Available	24-h	Not Available	None
1530	16637646	2006	FKRiVQRiKDFlRNLV	dLL-37(17-32)c	16	Linear	Mix	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KBv	Tumor	MTT/MTS assay	Not Available	24-h	Not Available	None
1529	16637646	2006	LLGDFKRIVQRIKDF	LL-37(1-4,17-27)	15	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KBv	Tumor	MTT/MTS assay	Not Available	24-h	Not Available	None
1528	16637646	2006	FKRIVQRIKDFLR	LL-37(17-29)	13	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KBv	Tumor	MTT/MTS assay	LC₅₀=60 µM	24-h	Not Available	None
1527	16637646	2006	FKRIVQRIKDFLRNLV	LL-37(17-32)b	16	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KBv	Tumor	MTT/MTS assay	LC₅₀=30 µM	24-h	Not Available	None
1526	16637646	2006	IGKEFKRIVQRIKDFLRNLVPRTES	LL-37(13-37)	25	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KBv	Tumor	MTT/MTS assay	LC₅₀=39 µM	24-h	Not Available	None
1525	16637646	2006	LLGDFFRKSKEK	LL-37(1-12)	12	Linear	L	None	Free	Free	Antibacterial	LL-37,a series of peptide fragments	KBv	Tumor	MTT/MTS assay	Not Available	24-h	Not Available	None
1423	16512752, 21403917	2006	AKRHHGYKRKFH	Demegen P-113	12	Linear	L	None	Amidation	Free	Antimicrobial	Amphibian skin peptide	U-937	Lymphoma Cancer	MTT/MTS assay	15% Cytotoxicity at 0.5 µg/ml	6-h	Blood	None
1422	10504394, 21403917	2009	GLFDVIKKVASVIGGL	Citropin1.1	16	Linear	L	None	Amidation	Free	Antibacterial	Australian blue mountains tree frog, Litoria citropa	U-937	Lymphoma Cancer	MTT/MTS assay	60% Cytotoxicity at 0.5 µg/ml	6-h	Blood	None
1421	10455241, 21403917	2009	GLFDVIKKVASVIGGL	Citropin1.1	16	Linear	L	None	Amidation	Free	Antibacterial	Australian blue mountains tree frog, Litoria citropa	U-937	Lymphoma Cancer	MTT/MTS assay	60% Cytotoxicity at 0.5 µg/ml	6-h	Blood	None
1353	18425992	2008	RKAFRWAWRMLKKAAPSITCVR	mPep1	22	Linear	L	None	Free	Free	Antimicrobial	Bovine lactoferrin (Lf-B)	HL-60	Skin Cancer	MTT/MTS assay	IC₅₀=8 µM	24-h	Blood	None
1352	18425992	2008	FKCRRWQWRMKKLGAPSITCVR	pep1	22	Linear	L	None	Free	Free	Antimicrobial	Bovine lactoferrin (Lf-B)	HL-60	Prostate Cancer	MTT/MTS assay	IC₅₀=77 µM	24-h	Blood	None
1350	18931881	2008	ETFSDLWKLL	PNC-28	10	Linear	L	None	Free	Free	Anticancer	Antennapedia	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	Cytotoxicity=80% µMo/ml	48-h	Pancreatic	None
1351	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	J82	Bladder Cancer	LDH leakage assay	Cytotoxicity=196.3 µg/ml	48-h	Bladder	None
1349	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	647V	Bladder Cancer	LDH leakage assay	IC₅₀=181.1 µg/ml	48-h	Bladder	None
1348	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	RT4	Bladder Cancer	LDH leakage assay	IC₅₀=240.4 µg/ml	48-h	Bladder	None
1347	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	486P	Bladder Cancer	LDH leakage assay	IC₅₀=232.4 µg/ml	48-h	Bladder	None
1344	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	J82	Bladder Cancer	LDH leakage assay	IC₅₀=319.2 µg/ml	48-h	Bladder	None
1343	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	647V	Bladder Cancer	LDH leakage assay	IC₅₀=200.7 µg/ml	48-h	Bladder	None
1342	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	RT4	Bladder Cancer	LDH leakage assay	IC₅₀=289.3 µg/ml	48-h	Bladder	None
1341	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	486P	Bladder Cancer	LDH leakage assay	IC₅₀=373.3/ µg/ml	48-h	Bladder	None
1338	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	J82	Bladder Cancer	Cell Viability assay	IC₅₀=77.51 µg/ml	48-h	Bladder	None
1337	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	647V	Bladder Cancer	Cell Viability assay	IC₅₀=61.86 µg/ml	48-h	Bladder	None
1336	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	RT4	Bladder Cancer	Cell Viability assay	IC₅₀=92.9 µg/ml	48-h	Bladder	None
1335	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	486P	Bladder Cancer	Cell Viability assay	IC₅₀=87.47 µg/ml	48-h	Bladder	None
1332	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	J82	Bladder Cancer	Cell Viability assay	IC₅₀=99.01 µg/ml	48-h	Bladder	None
1331	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	647V	Bladder Cancer	Cell Viability assay	IC₅₀=28.74 µg/ml	48-h	Bladder	None
1330	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	RT4	Bladder Cancer	Cell Viability assay	IC₅₀=96.22 µg/ml	48-h	Bladder	None
1329	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	486P	Bladder Cancer	Cell Viability assay	IC₅₀=69.2 µg/ml	48-h	Bladder	None
1326	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	J82	Bladder Cancer	WST-1 assay	IC₅₀=97.93 µg/ml	48-h	Bladder	None
1325	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	647V	Bladder Cancer	WST-1 assay	IC₅₀=115.12 µg/ml	48-h	Bladder	None
1324	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	RT4	Bladder Cancer	WST-1 assay	IC₅₀=184.81 µg/ml	48-h	Bladder	None
1323	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	486P	Bladder Cancer	WST-1 assay	IC₅₀=161.76 µg/ml	48-h	Bladder	None
1320	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	J82	Bladder Cancer	WST-1 assay	IC₅₀=212.07 µg/ml	48-h	Bladder	None
1319	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	647V	Bladder Cancer	WST-1 assay	IC₅₀=185.39 µg/ml	48-h	Bladder	None
1318	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	RT4	Bladder Cancer	WST-1 assay	IC₅₀=231.26 µg/ml	48-h	Bladder	None
1317	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	486P	Bladder Cancer	WST-1 assay	IC₅₀=251.47 µg/ml	48-h	Bladder	None
1314	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	486P(G4)	Bladder Cancer	Cell Viability assay	IC₅₀=59.4 µM	48-h	Bladder	None
1313	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	647V(G2)	Bladder Cancer	Cell Viability assay	IC₅₀=31 µM	48-h	Bladder	None
1312	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	RT4(G1)	Bladder Cancer	Cell Viability assay	IC₅₀=135.3 µM	48-h	Bladder	None
1311	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	486P(G4)	Bladder Cancer	WST-1 assay	IC₅₀=57.8 µM	48-h	Bladder	None
1310	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	647V(G2)	Bladder Cancer	WST-1 assay	IC₅₀=52.4 µM	48-h	Bladder	None
1308	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	486P(G4)	Bladder Cancer	LDH leakage assay	IC₅₀=28.6 µM	48-h	Bladder	None
1309	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	RT4(G1)	Bladder Cancer	WST-1 assay	IC₅₀=484 µM	48-h	Bladder	None
1307	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	647V(G2)	Bladder Cancer	LDH leakage assay	IC₅₀=54.1 µM	48-h	Bladder	None
1306	16476519	2006	GIGKFLHSAKKFGKAFVGEIMNS	Magainin 2	23	Linear	L	None	Amidation	Free	Antimicrobial	African clawed frog Xenopus laevis skin	RT4(G1)	Bladder Cancer	LDH leakage assay	IC₅₀=32.3 µM	48-h	Bladder	None
1115	16572423	2008	FKCRRWQWRMKKLGA	Lactoferricin B	15	Linear	L	None	Amidation	Free	Antimicrobial	Temporins family	SH-SY-5Y2	Brain Tumor	MTT/MTS assay	IC₅₀=60 µM	48-h	Brain	None
1113	16572423	2008	FKCRRWQWRMKKLGA	Lactoferricin B	15	Linear	L	None	Amidation	Free	Antimicrobial	Temporins family	SK-N-DZ	Brain Tumor	MTT/MTS assay	IC₅₀=37 µM	48-h	Brain	None
1114	16572423	2008	FKCRRWQWRMKKLGA	Lactoferricin B	15	Linear	L	None	Amidation	Free	Antimicrobial	Temporins family	SHEP-12	Brain Tumor	MTT/MTS assay	IC₅₀=45 µM	48-h	Brain	None
1112	16572423	2008	FKCRRWQWRMKKLGA	Lactoferricin B	15	Linear	L	None	Amidation	Free	Antimicrobial	Temporins family	IMR-32	Brain Tumor	MTT/MTS assay	IC₅₀=29 µM	48-h	Brain	None
1111	16572423	2008	FKCRRWQWRMKKLGA	Lactoferricin B	15	Linear	L	None	Amidation	Free	Antibacterial	Temporins family	Kelly	Brain Tumor	MTT/MTS assay	IC₅₀=15.5 µM	48-h	Brain	None
1110	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	DU-145	Prostate Cancer	MTT/MTS assay	IC₅₀=15.3 µg/ml	48-h	Prostate	None
1108	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SW-620	Colon Cancer	MTT/MTS assay	IC₅₀=12.7 µg/ml	48-h	Colon	None
1109	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	PC-3	Prostate Cancer	MTT/MTS assay	IC₅₀=12 µg/ml	48-h	Prostate	None
1107	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	KM12	Colon Cancer	MTT/MTS assay	IC₅₀=12 µg/ml	48-h	Colon	None
1106	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HT-29	Colon Cancer	MTT/MTS assay	IC₅₀=17.6 µg/ml	48-h	Colon	None
1105	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HCT-15	Colon Cancer	MTT/MTS assay	IC₅₀=13.2 µg/ml	48-h	Colon	None
1103	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	COLO-205	Colon Cancer	MTT/MTS assay	IC₅₀=11.2 µg/ml	48-h	Colon	None
1104	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HCT-116	Colon Cancer	MTT/MTS assay	IC₅₀=14.6 µg/ml	48-h	Colon	None
1102	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	Histone H2A	SK-OV-3	Ovarian Cancer	MTT/MTS assay	IC₅₀=12.6 µg/ml	48-h	Ovary	None
1101	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	OVRCAR-8	Ovarian Cancer	MTT/MTS assay	IC₅₀=13 µg/ml	48-h	Ovary	None
1100	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	OVRCAR-5	Ovarian Cancer	MTT/MTS assay	IC₅₀=13.8 µg/ml	48-h	Ovary	None
1099	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	OVRCAR-4	Ovarian Cancer	MTT/MTS assay	IC₅₀=17.6 µg/ml	48-h	Ovary	None
1098	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	OVRCAR-3	Ovarian Cancer	MTT/MTS assay	IC₅₀=15.2 µg/ml	48-h	Ovary	None
1097	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	IGROV1	Ovarian Cancer	MTT/MTS assay	IC₅₀=9 µg/ml	48-h	Ovary	None
1096	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	UO-31	Renal Cancer	MTT/MTS assay	IC₅₀=10.6 µg/ml	48-h	Renal	None
1094	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SN-12C	Renal Cancer	MTT/MTS assay	IC₅₀=11.4 µg/ml	48-h	Renal	None
1095	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	TK-10	Renal Cancer	MTT/MTS assay	IC₅₀=13.1 µg/ml	48-h	Renal	None
1093	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	RFX393	Renal Cancer	MTT/MTS assay	IC₅₀=11 µg/ml	48-h	Renal	None
1092	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	CAKI-1	Renal Cancer	MTT/MTS assay	IC₅₀=14.1 µg/ml	48-h	Renal	None
1091	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	ACHN	Renal Cancer	MTT/MTS assay	IC₅₀=12 µg/ml	48-h	Renal	None
1090	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	A-498	Renal Cancer	MTT/MTS assay	IC₅₀=10 µg/ml	48-h	Renal	None
1089	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	786-0	Renal Cancer	MTT/MTS assay	IC₅₀=12.2 µg/ml	48-h	Renal	None
1088	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	UACC-62	Skin Cancer	MTT/MTS assay	IC₅₀=10.6 µg/ml	48-h	Skin	None
1087	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	UACC-257	Skin Cancer	MTT/MTS assay	IC₅₀=12.5 µg/ml	48-h	Skin	None
1086	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SK-MEL-5	Skin Cancer	MTT/MTS assay	IC₅₀=8.9 µg/ml	48-h	Skin	None
1085	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SK-MEL-2	Skin Cancer	MTT/MTS assay	IC₅₀=11.1 µg/ml	48-h	Skin	None
1083	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	MALME-3M	Skin Cancer	MTT/MTS assay	IC₅₀=10.9 µg/ml	48-h	Skin	None
1084	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	M14	Skin Cancer	MTT/MTS assay	IC₅₀=15.1 µg/ml	48-h	Skin	None
1082	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	LOXIMVI	Skin Cancer	MTT/MTS assay	IC₅₀=9.5 µg/ml	48-h	Skin	None
1080	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SNB-75	Brain Tumor	MTT/MTS assay	IC₅₀=15.5 µg/ml	48-h	Brain	None
1081	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	U-251	Brain Tumor	MTT/MTS assay	IC₅₀=10.6 µg/ml	48-h	Brain	None
1079	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SNB-19	Brain Tumor	MTT/MTS assay	IC₅₀=13.8 µg/ml	48-h	Brain	None
1078	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SF-539	Brain Tumor	MTT/MTS assay	IC₅₀=9.5 µg/ml	48-h	Brain	None
1077	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SF-295	Brain Tumor	MTT/MTS assay	IC₅₀=12.9 µg/ml	48-h	Brain	None
1076	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SF-268	Brain Tumor	MTT/MTS assay	IC₅₀=12.4 µg/ml	48-h	Brain	None
1075	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	NCI-H522	Lung Cancer	MTT/MTS assay	IC₅₀=11.2 µg/ml	48-h	Lung	None
1074	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	NCI-H460	Lung Cancer	MTT/MTS assay	IC₅₀=12.1 µg/ml	48-h	Lung	None
1073	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	NCI-H322M	Lung Cancer	MTT/MTS assay	IC₅₀=10.7 µg/ml	48-h	Lung	None
1072	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	NCI-H23	Lung Cancer	MTT/MTS assay	IC₅₀=10.8 µg/ml	48-h	Lung	None
1071	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	NCI-H226	Lung Cancer	MTT/MTS assay	IC₅₀=13.3 µg/ml	48-h	Lung	None
1070	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HOP-92	Lung Cancer	MTT/MTS assay	IC₅₀=7.2 µg/ml	48-h	Lung	None
1069	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HOP-62	Lung Cancer	MTT/MTS assay	IC₅₀=12.6 µg/ml	48-h	Lung	None
1068	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	EKVX	Lung Cancer	MTT/MTS assay	IC₅₀=12.1 µg/ml	48-h	Lung	None
1067	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	A-549	Lung Cancer	MTT/MTS assay	IC₅₀=11.7 µg/ml	48-h	Lung	None
1066	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	T-47D	Breast Cancer	MTT/MTS assay	IC₅₀=23.9 µg/ml	48-h	Breast	None
1065	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	BT-549	Breast Cancer	MTT/MTS assay	IC₅₀=12.9 µg/ml	48-h	Breast	None
1064	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	MDA-N	Breast Cancer	MTT/MTS assay	IC₅₀=10.6 µg/ml	48-h	Breast	None
1063	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	MDA-MB-435	Breast Cancer	MTT/MTS assay	IC₅₀=11.3 µg/ml	48-h	Breast	None
1062	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HS578T	Breast Cancer	MTT/MTS assay	IC₅₀=11.7 µg/ml	48-h	Breast	None
1061	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	MDA-MB-231	Breast Cancer	MTT/MTS assay	IC₅₀=11.3 µg/ml	48-h	Breast	None
1060	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	NCI/ADR-RES	Breast Cancer	MTT/MTS assay	IC₅₀=11.5 µg/ml	48-h	Breast	None
1059	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	MCF-7	Breast Cancer	MTT/MTS assay	IC₅₀=15.1 µg/ml	48-h	Breast	None
1058	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	SR	Leukemia Cancer	MTT/MTS assay	IC₅₀=20.2 µg/ml	48-h	Blood	None
1057	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	RPMI-8226	Leukemia Cancer	MTT/MTS assay	IC₅₀=10.5 µg/ml	48-h	Blood	None
1056	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	MOLT-4	Leukemia Cancer	MTT/MTS assay	IC₅₀=17 µg/ml	48-h	Blood	None
1055	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	K-562	Leukemia Cancer	MTT/MTS assay	IC₅₀=8.2 µg/ml	48-h	Blood	None
1054	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	HL-60	Leukemia Cancer	MTT/MTS assay	IC₅₀=11.3 µg/ml	48-h	Blood	None
1053	18617323	2008	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	Linear	L	None	Free	Free	Antibacterial	histone H2A	CCRF-CEM	Leukemia Cancer	MTT/MTS assay	IC₅₀=14.7 µg/ml	48-h	Blood	None
4695	20623634	2010	Not Available	Ozarelix	Not Available	Linear	L	None	Free	Free	Anticancer	LHRH antagonist	PC-3	Prostate Cancer	Cell Proliferation assay	Inhibited cell proliferation in a dose and time-dependent manner	0-96 h	Prostate	None
4696	20623634	2010	Not Available	Ozarelix	Not Available	Linear	L	None	Free	Free	Anticancer	LHRH antagonist	DU-145	Prostate Cancer	Cell Proliferation assay	Inhibited cell proliferation in a dose and time-dependent manner	0-96 h	Prostate	None
4690	26125720	2007	QPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSF	Endostatin	172	Linear	L	None	Free	Free	Antiangiogenic	P. pastoris	MFC	Stomach Cancer	IP injections	Tumor inhibition rate = 72.89%	14 days	Stomach	None