CancerPPD 2.0 - Browse by Length

Browsing by Length

Browse Results:

Filter by Year
From
Upto

ID	PMID	YEAR	Sequence	Name	Length	Linear/Cyclic	Chirality	Chem-MOD	C-ter MOD	N-ter MOD	Nature	Origin	Cell Line	Cancer Type	Assay	Activity	Testing Time	Tissue Affected	Patents
7704	38491556	2024	AAEKEFIKYPYPTPLQYQQLATRLKVEKKLVRRW	HMM-ID	34	Linear	L	None	Free	Free	Anticancer	Red Sea Brine	U2OS	Osteosarcoma	MTT assay	IC₅₀ = 100.5 µg/ml	24-h	Bone	None
7607	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	HCT-116	Colon Cancer	LDH leakage assay	LDH release above 80%	24-h	Colon	None
7606	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 2.02 μM	24-h	Colon	None
7605	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 2.32 μM	24-h	Brain	None
7604	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	MDA-MB-435	Breast Cancer	MTT assay	IC₅₀ = 18.99 μM	24-h	Breast	None
7603	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	H-460	Lung Cancer	MTT assay	IC₅₀ = 3.47 μM	24-h	Lung	None
7601	36626098	2023	FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD	LFchimera	35	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic - Lectoferrin chimera	Jurkat	Blood Cancer	MTT assay	cell viability ~ 8% at 20 µM	6-h	Blood	None
7600	36626098	2023	FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD	LFchimera	35	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic - Lectoferrin chimera	HepG-2	Liver Cancer	MTT assay	cell viability ~ 44% at 10 µM	12-h	Liver	None
7494	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	ZR-75-30	Breast Cancer	Cell Viability assay	IC₅₀ = 12.92 µM	72-h	Breast	None
7493	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	U-251	BrainTumor	Cell Viability assay	IC₅₀ = 18.17 µM	72-h	Brain	None
7492	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	Cell Viability assay	IC₅₀ = 22.00 µM	72-h	Lung	None
7491	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	HCT-116	Colon Cancer	Cell Viability assay	IC₅₀ = 9.08 µM	72-h	Colon	None
7490	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	786-0	Renal Cancer	Cell Viability assay	IC₅₀ = 13.5 µM	72-h	Renal	None
7489	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	Cell Viability assay	IC₅₀ = 31.83 µM	72-h	Cervix	None
7488	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	5637	Bladder cancer	Cell Viability assay	IC₅₀ = 9.33 µM	72-h	Bladder	None
7487	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	Cell Viability assay	IC₅₀ = 24.25 µM	72-h	Breast	None
7443	37495988	2023	TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC	37-mer peptide	37	Linear	L	None	Free	Free	Antimicrobial	Synthetic	SK-OV-3	Ovarian cancer	MTT assay	IC₅₀ = 27.45 ± 1.5085 μM	24-h	Ovary	None
7442	37495988	2023	TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC	37-mer peptide	37	Linear	L	None	Free	Free	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 33.65 ± 1.09 μM	24-h	Liver	None
7441	37495988	2023	TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC	37-mer peptide	37	Linear	L	None	Free	Free	Antimicrobial	Synthetic	SNU-449	Liver Cancer	MTT assay	IC₅₀ = 76.4 ± 0.6015 μM	24-h	Liver	None
7312	35246758	2022	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin ZP	34	Cyclic	L	None	Cyclized	Cyclized	Antimicrobial	Lactococcus lactis	H-1299	Lung Cancer	MTT assay	IC₅₀ = 137.3 ± 9.1 μM	48-h	Lung	None
7311	35246758	2022	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin ZP	34	Cyclic	L	None	Cyclized	Cyclized	Antimicrobial	Lactococcus lactis	A-549	Lung Cancer	MTT assay	IC₅₀ = 132.4 ± 6.4 μM	48-h	Lung	None
7292	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	T98G	Brain Tumor	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Brain	None
7291	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Lung	None
7290	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	DU-145	Prostate Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Prostate	None
7289	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	A-375	Skin Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Skin	None
7288	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Breast	None
7287	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	U-251	Brain Tumor	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Brain	None
6862	34789753	2021	GFLDIIKDTGKEFAVKILNNLKCKLAGGCPP	Palustrin - Ca	31	Linear	L	None	Free	Free	Host Defence Peptide	Lithobates catesbeianus	SGC-7901	Gastric Cancer	Not Available	IC₅₀ = 0.951 μg/ml	Not Available	Stomach	None
6834	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	HT-29	Colon Cancer	MTT assay	Not Available	Not Available	Colon	None
6833	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	RKO	Colon Cancer	MTT assay	25% cell viability at at 20 μM	24-h	Colon	None
6832	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	HCT-15	Colon Cancer	MTT assay	Not Available	Not Available	Colon	None
6831	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	HCT-116	Colon Cancer	MTT assay	20% cell viability at at 20 μM	24-h	Colon	None
6813	34309373	2021	FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ	Pal-pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid; pFL - a hydrophobic peptide fragment (FPWWWPFL) rich in tryptophan (W)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 11.85 μM	24-h	Breast	None
6812	34309373	2021	FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ	Pal-pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid; pFL - a hydrophobic peptide fragment (FPWWWPFL) rich in tryptophan (W)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-549	Lung Cancer	MTT assay	IC₅₀ = 31.17 μM	24-h	Lung	None
6811	34309373	2021	FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ	Pal-pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid; pFL - a hydrophobic peptide fragment (FPWWWPFL) rich in tryptophan (W)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-375	Skin Cancer	MTT assay	IC₅₀ = 5.5 ± 1.1 μM	24-h	Skin	None
6810	34309373	2021	FPWWWPFL-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ	pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	pFL = hydrophobic peptide fragment (FPWWWPFL)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-375	Skin Cancer	MTT assay	IC₅₀ = 11.1 ± 0.1 μM	24-h	Skin	None
6782	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	LoVo	Colon Cancer	MTT assay	IC₅₀ = 128 µM	24-h	Colon	None
6781	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	HeLa	Cervical Cancer	MTT assay	IC₅₀ > 128 µM	24-h	Cervix	None
6780	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	MCF-7	Breast Cancer	MTT assay	IC₅₀ > 128 µM	24-h	Breast	None
6779	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	A-549	Lung Cancer	MTT assay	IC₅₀ > 128 µM	24-h	Lung	None
6765	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	LoVo	Colon Cancer	MTT assay	IC₅₀ = 35.05 µM	24-h	Colon	None
6764	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 23.26 µM	24-h	Cervix	None
6763	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 37.84 µM	24-h	Breast	None
6762	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	A-549	Lung Cancer	MTT assay	IC₅₀ = 24.01 µM	24-h	Lung	None
6761	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	LoVo	Colon Cancer	MTT assay	IC₅₀ = 55.22 µM	24-h	Colon	None
6760	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 52.83 µM	24-h	Cervix	None
6759	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 41.21 µM	24-h	Breast	None
6758	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	A-549	Lung Cancer	MTT assay	IC₅₀ = 27.31 µM	24-h	Lung	None
6757	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	LoVo	Colon Cancer	MTT assay	IC₅₀ = 59.78 µM	24-h	Colon	None
6755	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 45.25 µM	24-h	Breast	None
6756	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 37.23 µM	24-h	Cervix	None
6754	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	A-549	Lung Cancer	MTT assay	IC₅₀ = 15.32 µM	24-h	Lung	None
6753	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	LoVo	Colon Cancer	MTT assay	IC₅₀ = 8.05 µg/ml	24-h	Colon	None
6752	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 19.69 µg/ml	24-h	Cervix	None
6751	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 25.74 µg/ml	24-h	Breast	None
6750	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	A-549	Lung Cancer	MTT assay	IC₅₀ = 2.975 µg/ml	24-h	Lung	None
6657	33029595	2020	{[LLKKLLKK]₂kC}₂	4-arm branched peptide	36	Linear	L	thermal oxidation between the thiol group of cysteine residue in the two 2-arm branched	Free	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	Cell Viability (%) ~ 49.0 ± 0.8 at 30 µg/mL	48-h	Prostate	None
6656	33029595	2020	{[LLKKLLKK]₂kC}₂	4-arm branched peptide	36	Linear	L	thermal oxidation between the thiol group of cysteine residue in the two 2-arm branched	Free	Free	Antimicrobial	Synthetic	Bcap-37	Breast Cancer	MTT assay	Cell Viability (%) ~ 51.4 ± 4.2 at 30 µg/mL	48-h	Breast	None
6654	33029595	2020	{[LLKKLLKK]₂kC}₂	4-arm branched peptide	36	Linear	L	thermal oxidation between the thiol group of cysteine residue in the two 2-arm branched	Free	Free	Antimicrobial	Synthetic	SK-HEP-1	Liver Cancer	MTT assay	Cell Viability (%) ~ 31.7 ± 5.1 at 30 µg/mL	48-h	Liver	None
6655	33029595	2020	{[LLKKLLKK]₂kC}₂	4-arm branched peptide	36	Linear	L	thermal oxidation between the thiol group of cysteine residue in the two 2-arm branched	Free	Free	Antimicrobial	Synthetic	HCT-116	Colon Cancer	MTT assay	Cell Viability (%) ~ 67.6 ± 5.8 at 30 µg/mL	48-h	Colon	None
6579	31940927	2020	GPKTKAACKMACKLATCGKKPGGWKCKLCELGCDAV	Turgencin A	36	Cyclic(C8-C33,C12-C29,C17-C26)	L	None	Amidation	Free	Antimicrobial and Anticancer	Synoicum turgens	A-2058	Skin Cancer	Cell Viability assay	IC₅₀ 1.4 µM	72-h	Skin	None
6578	31940927	2020	GIKEMLCNMACAQTVCKKSGGPLCDTCQAACKALG	Turgencin B	35	Cyclic(C7-C31,C11-C27,C16-C24)	L	None	Amidation	Free	Antimicrobial and Anticancer	Synoicum turgens	A-2058	Skin Cancer	Cell Viability assay	IC₅₀ 4.1 µM	72-h	Skin	None
6534	33237335	2020	MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC	MzDef	34	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Zea mays L.	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 29.85 µg/mL	24-h	Colon	None
6533	33237335	2020	MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC	MzDef	34	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Zea mays L.	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 14.85 µg/mL	24-h	Breast	None
6532	33237335	2020	MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC	MzDef	34	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Zea mays L.	HepG-2	Liver Cancer	MTT assay	IC₅₀ ~ 22 µg/mL	24-h	Liver	None
6216	30461197	2019	ALWKTMLKKLGTVALHAGKAALGAVADTISQ	Dermaseptin-PS1	31	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa sauvagei	U251-MG	Brain Tumor	LDH leakage assay	20% LDH release at 10⁻⁴ M	24-h	Brain	None
6215	30461197	2019	ALWKTMLKKLGTVALHAGKAALGAVADTISQ	Dermaseptin-PS1	31	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa sauvagei	U251-MG	Brain Tumor	MTT assay	5.419 μmol/L	24-h	Brain	None
6212	31234333	2019	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensi	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 2.02 µM	24-h	Colon	None
6211	31234333	2019	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensi	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 2.32 µM	24-h	Brain	None
6210	31234333	2019	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensi	MDA-MB-435S	Breast Cancer	MTT assay	IC₅₀ = 18.99 µM	24-h	Breast	None
6209	31234333	2019	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensi	H-460	Lung Cancer	MTT assay	IC₅₀ = 3.47 µM	24-h	Lung	None
5980	29628917	2018	NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN	DLP-PH	36	Linear	L	None	Free	Free	Antimicrobial	Phyllomedusa hypochondrialis	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 32.25 μg/mL	24-h	Prostate	None
5979	29628917	2018	NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN	DLP-PH	36	Linear	L	None	Free	Free	Antimicrobial	Phyllomedusa hypochondrialis	H-157	Lung Cancer	MTT assay	IC₅₀ = 15.41 μg/mL	24-h	Lung	None
5978	30481557	2018	HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK	PACAP38	38	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Clarias gariepinus	H-460	Lung Cancer	Crystal Violet assay	IC₅₀=14.97± 1.16 µM	48-h	Lung	None
5975	30483133	2018	GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI	myristoyl-CM4	36	Linear	L	None	Amidation	N-myristoylation	Antimicrobial	Bombyx mori	MCF-7	Breast cancer	MTT assay	IC₅₀ = 6 μM	24-h	Breast	None
5976	30483133	2018	GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI	myristoyl-CM4	36	Linear	L	None	Amidation	N-myristoylation	Antimicrobial	Bombyx mori	MDA-MB-231	Breast cancer	MTT assay	IC₅₀ = 4 μM	24-h	Breast	None
5977	30483133	2018	GRWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI	myristoyl-CM4	36	Linear	L	None	Amidation	N-myristoylation	Antimicrobial	Bombyx mori	MX-1	Breast cancer	MTT assay	IC₅₀ = 3 μM	24-h	Breast	None
5967	29875773	2018	RRRRRRRRRRRIKKKRKWEASALVCIRLVTSSKPRTVa	R11-NLS-pep8	38	Linear	Mix	None	Free	Acetylation	Anticancer	NKp44 derived synthetic peptide	MDA-MD-231	Breast Cancer	PrestoBlue assay	ED50 = 5.6 μM	24-h	Breast	None
5966	29875773	2018	RRRRRRRRRRRIKKKRKWEASALVCIRLVTSSKPRTVa	R11-NLS-pep8	38	Linear	Mix	None	Free	Acetylation	Anticancer	NKp44 derived synthetic peptide	HepG-2	Liver Cancer	PrestoBlue assay	ED50 = 5.9 μM	24-h	Liver	None
5965	29875773	2018	RRRRRRRRRRRIKKKRKWEASALVCIRLVTSSKPRTVa	R11-NLS-pep8	38	Linear	Mix	None	Free	Acetylation	Anticancer	NKp44 derived synthetic peptide	PANC-1	Pancreatic Cancer	PrestoBlue assay	ED50 = 7.8 μM	24-h	Pancreas	None
5964	29875773	2018	RRRRRRRRRRRIKKKRKWEASALVCIRLVTSSKPRTVa	R11-NLS-pep8	38	Linear	Mix	None	Free	Acetylation	Anticancer	NKp44 derived synthetic peptide	B-16	Skin Cancer	PrestoBlue assay	ED50 = 7.1 μM	24-h	Skin	None
5951	29054798	2018	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin Z	34	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Lactococcus lactis	A-375	Skin Cancer	LDH leakage assay	60% LDH release at 60 µM	24-h	Skin	None
5950	29054798	2018	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin Z	34	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Lactococcus lactis	A-375	Skin Cancer	MTT assay	IC₅₀ = 188.5 ± 8.7 µM	24-h	Skin	None
5731	28867631	2017	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin Z	34	Cyclic	L	None	Cyclized	Cyclized	Antimicrobial	Lactococcus lactis	SW-480	Colon Cancer	MTT assay	79.22% cytotoxicity at 1000 μg/mL	24-h	Colon	None
5719	28347740	2017	RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK	ABP-dHC-Cecropin A-K(24)	37	Linear	L	None	Free	Free	Host Defence Peptide	Synthetic	THP-1	Leukemia Cancer	MTT assay	IC₅₀ = 196.1 μM	24-h	Blood	None
5718	28347740	2017	RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK	ABP-dHC-Cecropin A-K(24)	37	Linear	L	None	Free	Free	Host Defence Peptide	Synthetic	U-937	Leukemia Cancer	MTT assay	IC₅₀ = 223.9 μM	24-h	Blood	None
5717	28347740	2017	RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK	ABP-dHC-Cecropin A-K(24)	37	Linear	L	None	Free	Free	Host Defence Peptide	Synthetic	K-562	Leukemia Cancer	MTT assay	IC₅₀ = 184.9 μM	24-h	Blood	None
5716	28347740	2017	RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK	ABP-dHC-Cecropin A	37	Linear	L	None	Free	Free	Host Defence Peptide	Synthetic	THP-1	Leukemia Cancer	MTT assay	IC₅₀ = 228.5 μM	24-h	Blood	None
5715	28347740	2017	RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK	ABP-dHC-Cecropin A	37	Linear	L	None	Free	Free	Host Defence Peptide	Synthetic	U-937	Leukemia Cancer	MTT assay	IC₅₀ = 303.2 μM	24-h	Blood	None
5714	28347740	2017	RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK	ABP-dHC-Cecropin A	37	Linear	L	None	Free	Free	Host Defence Peptide	Synthetic	K-562	Leukemia Cancer	MTT assay	IC₅₀ = 349.5 μM	24-h	Blood	None
5710	28157321	2017	GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL	MccJ25-18-4	31	Linear	Mix	x = Norleucine	Free	Free	Antimicrobial	Synthetic	MDA-MB-435-MDR	Breast Cancer	MTT assay	IC₅₀ = 25.0 ± 0.5 μM	48-h	Breast	None
5709	28157321	2017	GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL	MccJ25-18-4	31	Linear	Mix	x = Norleucine	Free	Free	Antimicrobial	Synthetic	MDA-MB-435	Breast Cancer	MTT assay	IC₅₀ = 20.0 ± 0.5 μM	48-h	Breast	None
5708	28157321	2017	GGAGHVPEYFVGIGTPISFYG-WxEAAYQrFL	MccJ25-18-4	31	Linear	Mix	x = Norleucine	Free	Free	Antimicrobial	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 14.2 ± 1.5 μM	48-h	Breast	None
5550	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	PC-3	Prostate Cancer	LDH leakage assay	100% cytotoxicity at 2.5 μM	3-h	Prostate	None
5549	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	LNCaP	Prostate Cancer	Crystal Violet assay	GI₅₀ = 2.65 ± 1.09 μM	24-h	Prostate	None
5548	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	PC-3	Prostate Cancer	Crystal Violet assay	GI₅₀ = 2.17 ± 0.48 μM	24-h	Prostate	None
5547	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	DU-145	Prostate Cancer	Crystal Violet assay	GI₅₀ = 0.71 ± 0.55 μM	24-h	Prostate	None
5546	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	A-375	Skin Cancer	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Skin	None
5545	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	SK-Mel-28	Skin Cancer	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Skin	None
5544	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	HT-144	Skin Cancer	Crystal Violet assay	GI₅₀ = 5.08 ± 0.72 μM	24-h	Skin	None
5543	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	MIA PaCa-2	Pancreatic Cancer	Crystal Violet assay	GI₅₀ = 7.91 ± 1.40 μM	24-h	Pancreas	None
5542	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	BxPC-3	Pancreatic Cancer	Crystal Violet assay	GI₅₀ = 2.31 ± 0.41 μM	24-h	Pancreas	None
5541	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	PANC-1	Pancreatic Cancer	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Pancreas	None
5540	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	MDA-MB-453	Breast Cancer	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Breast	None
5539	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	BT-474	Breast Cancer	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Breast	None
5538	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	MDA-MB-231	Breast Cancer	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Breast	None
5537	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	U-373-MG	Brain Tumor	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Brain	None
5536	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	U-138-MG	Brain Tumor	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Brain	None
5535	28797092	2017	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Dermaseptin - B2	33	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa bicolor	U-87-MG	Brain Tumor	Crystal Violet assay	GI₅₀ > 10 μM	24-h	Brain	None
5321	26831010	2016	VCMPCFTTDQQMARKCSDCCGGKGRGKCYGPQCLCR	CTX-23	36	Linear	L	None	Free	Free	Anticancer	Synthetic	U-251	Brain Tumor	MTT assay	Graph Figure 2	48-h	Brain	None
5320	26831010	2016	CGPCFTTDHNMARKCDECCGGKGRGKCFGPQCLCR	CA4	35	Linear	L	None	Free	Free	Anticancer	Synthetic	U-251	Brain Tumor	MTT assay	Graph Figure 2	48-h	Brain	None
5290	27187467	2016	GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI	dermaseptin-PD-2	33	Linear	L	None	Free	Free	Antimicrobial	phyllomedusine leaf frogs,Pachymedusa dacnicolor	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 13.43 μM	24-h	Brain	None
5289	27187467	2016	GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI	dermaseptin-PD-2	33	Linear	L	None	Free	Free	Antimicrobial	phyllomedusine leaf frogs,Pachymedusa dacnicolor	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 3.17 μM	24-h	Prostate	None
5288	27187467	2016	GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI	dermaseptin-PD-2	33	Linear	L	None	Free	Free	Antimicrobial	phyllomedusine leaf frogs,Pachymedusa dacnicolor	H-157	Lung Cancer	MTT assay	IC₅₀ = 6.43 μM	24-h	Lung	None
5287	27187467	2016	GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ	dermaseptin-PD-1	31	Linear	L	None	Free	Free	Antimicrobial	phyllomedusine leaf frogs,Pachymedusa dacnicolor	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 15.08 μM	24-h	Brain	None
5183	25821084	2015	CVLIGQRCDNDRGPRCCSGQGNCVPLPFLGGVCAV	Ep-AMP1	35	Cyclic	L	None	Cyclized	Cyclized	Antibacterial and Anticancer	Echinopsis pachanoi	U-937/GTB	Lymphoma cancer	Fluorometric microculture cytotoxicity assay	IC₅₀ > 100 µM	Not Available	Blood	None
5169	26703631	2015	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	Linear	L	None	Free	Free	Antimicrobial	Pardachirus marmoratus	OSCC-SCC-4	Oral cancer	MTT assay	Cell Viability <20% at 20μg/mL	24-h	Not Available	None
5158	26064310	2015	GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD	DC1	32	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Hedyotis diffusa	DU-145	Liver Cancer	CCK-8 assay	IC₅₀ = 3.32 μM	72-h	Liver	None
5157	26064310	2015	GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD	DC1	32	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Hedyotis diffusa	PC-3	Prostate Cancer	CCK-8 assay	IC₅₀ = 2.24 μM	72-h	Prostate	None
5156	26064310	2015	GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD	DC1	32	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Hedyotis diffusa	LNCaP	Prostate Cancer	CCK-8 assay	IC₅₀ = 5.03 μM	72-h	Prostate	None
5155	26064310	2015	GAVPCGETCVYLPCITPDIGCSCQNKVCYRD	DC2	31	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Hedyotis diffusa	DU-145	Liver Cancer	CCK-8 assay	IC₅₀ = 3.11 μM	72-h	Liver	None
5154	26064310	2015	GAVPCGETCVYLPCITPDIGCSCQNKVCYRD	DC2	31	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Hedyotis diffusa	PC-3	Prostate Cancer	CCK-8 assay	IC₅₀ = 2.65 μM	72-h	Prostate	None
5153	26064310	2015	GAVPCGETCVYLPCITPDIGCSCQNKVCYRD	DC2	31	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Hedyotis diffusa	LNCaP	Prostate Cancer	CCK-8 assay	IC₅₀ = 4.31 μM	72-h	Prostate	None
5010	24661024	2014	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Free	Free	Antimicrobial	Isolated from the giant silk moth Hyalophora cecropia	SCC25	Skin Cancer	Cell Viability assay	107.0 ± 5.0% cell growth inhibition at 1 µM	24-h	Skin	None
5009	24661024	2014	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Free	Free	Antimicrobial	Isolated from the giant silk moth Hyalophora cecropia	SCC25	Skin Cancer	Cell Viability assay	0.6 ± 0.6% cell growth inhibition at 10 µM	48-h	Skin	None
5008	24661024	2014	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Free	Free	Antimicrobial	Isolated from the giant silk moth Hyalophora cecropia	SCC25	Skin Cancer	MTT/MTS assay	IC₅₀=2.2 µM	48-h	Skin	None
5007	24661024	2014	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Free	Free	Antimicrobial	Isolated from the giant silk moth Hyalophora cecropia	SCC12	Skin Cancer	MTT/MTS assay	IC₅₀=1 µM	48-h	Skin	None
5006	24587350	2014	[LL-37, 37 aa]	LL 37	37	Linear	L	None	Free	Free	Antimicrobial	Also known human cathelicidin	OVRCAR-3	Ovarian Cancer	MTT/MTS assay	LC₅₀= 24 at 100 µM	72-h	Ovary	None
5004	24587350	2014	[LL-37, 37 aa]	LL 37	37	Linear	L	None	Free	Free	Antimicrobial	Also known human cathelicidin	LNCaP	Prostate cancer	MTT/MTS assay	LC₅₀= 27 at 100 µM	72-h	Prostate	None
5002	24587350	2014	[LL-37, 37 aa]	LL 37	37	Linear	L	None	Free	Free	Antimicrobial	Also known human cathelicidin	MCF-7	Breast Cancer	MTT/MTS assay	LC₅₀= 21 at 100 µM	72-h	Breast	None
4601	15496597	2004	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	CB	36	Linear	L	None	Free	Free	Antibacterial	Synthetic	Ags	Gastric Cancer	Not Available	Not Available	Not Available	Stomach	None
4600	21351323	2011	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EGFR-lytic	32	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	MDA-MB-231	Breast Cancer	ELISA	IC₅₀ =0.46 µM	15-Min	Breast	None
4599	21351323	2011	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EGFR-lytic	32	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	MDA-MB-231	Breast Cancer	ELISA	IC₅₀ =0.12 µM	60-Min	Breast	None
4453	17561225, 18957441	2007	LLGMIPLAISAISALSKL	Phylloseptin-L1	32	Not Available	L	None	Free	Free	Anticancer	Hylomantis lemur (Hylidae: Phyllomedusinae	Not Available	Colorectal Cancer	Not Available	Not Available	Not Available	Not Available	None
4452	17561225, 18957441	2007	GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS	Phylloseptin	32	Not Available	L	None	Free	Free	Anticancer	Hylomantis lemur (Hylidae: Phyllomedusinae	Not Available	Colorectal Cancer	Not Available	Not Available	Not Available	Not Available	None
4434	7628632, 18957441	1995	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK	hBD-1	36	Not Available	L	None	Free	Free	Antibacterial	keratinocytes; skin; platelets;Homo sapiens	Not Available	Fibrosarcoma	Not Available	Not Available	Not Available	Fibrous connective tissue	None
4423	18191970, 18957441	2008	GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN	Vibi H	31	Not Available	L	None	Free	Free	Anticancer	Alpine violetViola biflora	Not Available	Lung Cancer	Not Available	Not Available	Not Available	Not Available	None
4420	7916722, 18957441	1993	GWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLK	Cecropin 2	39	Not Available	L	None	Free	Free	Antibacterial	The Medfly, Ceratitis capitata; also housefly, Musca domestica	Not Available	Leukemia Cancer	Not Available	Not Available	Not Available	Not Available	None
4418	18191970, 18957441	2008	GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN	Vibi G	31	Not Available	L	None	Free	Free	Anticancer	Alpine violetViola biflora	Not Available	Skin Cancer	Not Available	Not Available	Not Available	Not Available	None
4396	20575512, 18957441	2010	GVIPCGESCVFIPCISSVLGCSCKNKVCYRD	Psyle E	31	Not Available	L	None	Free	Free	Antibacterial	Psychotria leptothyrsa	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4379	21723349, 18957441	2011	GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN	Viphi G	31	Not Available	L	None	Free	Free	Antibacterial	Viola philippica	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4375	21723349, 18957441	2011	GSIPCGESCVFIPCISAIIGCSCSSKVCYKN	Viphi F	31	Not Available	L	None	Free	Free	Antibacterial	Viola philippica	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4374	21723349, 18957441	2011	GSIPCGESCVFIPCISSVIGCACKSKVCYKN	Viphi F	31	Not Available	L	None	Free	Free	Antibacterial	Viola philippica	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4373	21723349, 18957441	2011	GSIPCGESCVFIPCISAVIGCSCSNKVCYKN	Viphi E	31	Not Available	L	None	Free	Free	Antibacterial	Viola philippica	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4372	22467870, 18957441	2012	GIPCAESCVWIPPCTITALMGCSCKNNVCYNN	Chassatide C2	32	Not Available	L	None	Free	Free	Antibacterial	Chassalia chartacea	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
4350	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 7.9 µM	48-h	Pancreatic	WO_2010_064207_A2
4349	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	Pane- 1	Breast Cancer	WST-1 assay	IC₅₀= 13.1 µM	48-h	Breast	WO_2010_064207_A2
4348	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	CFPAC-I	Pancreatic Cancer	WST-1 assay	IC₅₀= 10.6 µM	48-h	Pancreatic	WO_2010_064207_A2
4347	None	2009	NYQWVPYQGRVPYPRGGLLkLLKklLKKLlKL	Sema3A(aa363-377) -nLytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 12.5 µM	48-h	Pancreatic	WO_2010_064207_A2
4346	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	LNCaP	Prostate Cancer	WST-1 assay	IC₅₀= 4.8 µM	Not Available	Prostate	US_8436137_B2
4345	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 7.4 µM	Not Available	Pancreatic	US_8436137_B2
4344	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 6.6 µM	Not Available	Pancreatic	US_8436137_B2
4343	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	U-251	Brain Tumor	WST-1 assay	IC₅₀= 8.4 µM	Not Available	Brain	US_8436137_B2
4342	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BT-20	Breast Cancer	WST-1 assay	IC₅₀= 1.9 µM	Not Available	Breast	US_8436137_B2
4341	None	2009	YRWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB(H2R)-lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	H-322	Lung Cancer	WST-1 assay	IC₅₀= 3.2 µM	Not Available	Lung	US_8436137_B2
4340	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	LNCaP	Prostate Cancer	WST-1 assay	IC₅₀= 10 µM	Not Available	Prostate	US_8436137_B2
4339	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀= 12 µM	Not Available	Pancreatic	US_8436137_B2
4338	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BxPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀= 12 µM	Not Available	Pancreatic	US_8436137_B2
4337	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	U-251	Brain Tumor	WST-1 assay	IC₅₀= 12 µM	Not Available	Brain	US_8436137_B2
4336	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	BT-20	Breast Cancer	WST-1 assay	IC₅₀= 6.5 µM	Not Available	Breast	US_8436137_B2
4335	None	2009	YHWYGYTPQNVIGGGKLlLKlLkkLLKlLKKK	EB-Lytic	32	Linear	Mix	None	Free	Free	Anticancer	Synthetic Peptide	H-322	Lung Cancer	WST-1 assay	IC₅₀= 6.8 µM	Not Available	Lung	US_8436137_B2
4238	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	50% apoptosis at 50 µM	8-h	Not Available	None
4237	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	20% apoptosis at 20 µM	8-h	Not Available	None
4236	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	IMR5	Tumor	MTT/MTS assay	15% apoptosis at 10 µM	8-h	Not Available	None
4235	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	30% apoptosis at 50 µM	8-h	Not Available	None
4234	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	>50% apoptosis at 20 µM	8-h	Not Available	None
4233	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NGP	Tumor	MTT/MTS assay	20% apoptosis at 10 µM	8-h	Not Available	None
4232	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	80% apoptosis at 50 µM	8-h	Brain	None
4231	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	80% apoptosis at 20 µM	8-h	Brain	None
4230	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	NB69	Brain Tumor	MTT/MTS assay	30% apoptosis at 10 µM	8-h	Brain	None
4229	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	30% apoptosis at 50 µM	8-h	Brain	None
4228	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	10% apoptosis at 20 µM	8-h	Brain	None
4227	16568093	2006	rrrrrrrrGNLWAAQRYGRELRRMSDEFVDSFKK	r8-BadBH3	35	Linear	Mix	None	Free	Free	Antitumor	Synthetic Peptide	SK-N-AS	Brain Tumor	MTT/MTS assay	0% apoptosis at 10 µM	8-h	Brain	None
3188	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	ED₅₀ =0.29 µM	24-h	Blood	None
3187	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	ED₅₀ >10 µM	24-h	Colon	None
3186	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	ED₅₀ =0.210 µM	24-h	Pancreatic	None
3185	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	ED₅₀ =2.1 µM	24-h	Oral mucosa	None
3184	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	94.5 % inhibition of cell proliferation at 10 µM	24-h	Blood	None
3183	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	54.3 % inhibition of cell proliferation at 1 µM	24-h	Blood	None
3182	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	34.7 % inhibition of cell proliferation at 100 nM	72-h	Blood	None
3181	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	18.7 % inhibition of cell proliferation at 10 nM	24-h	Blood	None
3180	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MOLT-4	Leukemia Cancer	MTT/MTS assay	10.4 % inhibition of cell proliferation at 1 nM	24-h	Blood	None
3179	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	27.9 % inhibition of cell proliferation at 10 µM	24-h	Colon	None
3178	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	21.7 % inhibition of cell proliferation at 1 µM	24-h	Colon	None
3177	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	16.8 % inhibition of cell proliferation at 100 nM	72-h	Colon	None
3176	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	14.2 % inhibition of cell proliferation at 10 nM	24-h	Colon	None
3175	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	PTC	Colon Cancer	MTT/MTS assay	16.5 % inhibition of cell proliferation at 1 nM	24-h	Colon	None
3174	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	84.5 % inhibition of cell proliferation at 10 µM	24-h	Pancreatic	None
3173	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	59.6 % inhibition of cell proliferation at 1 µM	24-h	Pancreatic	None
3172	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	48.2 % inhibition of cell proliferation at 100 nM	72-h	Pancreatic	None
3171	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	37.8 % inhibition of cell proliferation at 10 nM	24-h	Pancreatic	None
3170	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	MiaPaCa.2	Pancreatic Cancer	MTT/MTS assay	24.2 % inhibition of cell proliferation at 1 nM	24-h	Pancreatic	None
3169	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	98.3 % inhibition of cell proliferation at 10 µM	24-h	Oral mucosa	None
3168	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	43.1 % inhibition of cell proliferation at 1 µM	24-h	Oral mucosa	None
3167	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	30.7 % inhibition of cell proliferation at 100 nM	72-h	Oral mucosa	None
3166	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	18.2 % inhibition of cell proliferation at 10 nM	24-h	Oral mucosa	None
3165	17559067	2007	fCYwO-CyLeu-Pen-TKKrPKPfQwFwL-CyLeu-KKLMYPTYLKKfQWAV-Aib-HL	Peptide 5	40	Linear	Mix	Aib = = 1-amino-isobutyric acid, O= Ornithine, Pen=penicillamine, CyLeu=cycloleucine or 1-aminocyclopentane-1-carboxylic acid and disulfide bond between Cys and Pen	Amidation	Free	Anticancer	Synthetic peptide of four designed analogs of vasoactive intestinal peptide, bombesin, substance P a	KB	Oral Cancer	MTT/MTS assay	10.6 % inhibition of cell proliferation at 1 nM	24-h	Oral mucosa	None
3031	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	10 % Cytotoxicity at 3.125 mg/L	24-h	Fibrous connective tissue	None
3030	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	5 % Cytotoxicity at 6.25 mg/L	24-h	Fibrous connective tissue	None
3028	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	90 % Cytotoxicity at 25 mg/L	24-h	Fibrous connective tissue	None
3029	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	15 % Cytotoxicity at 12.5 mg/L	24-h	Fibrous connective tissue	None
3027	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	90 % Cytotoxicity at 50 mg/L	24-h	Fibrous connective tissue	None
3026	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	38 % Cytotoxicity at 3.125 mg/L	12-h	Fibrous connective tissue	None
3024	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	39 % Cytotoxicity at 12.5 mg/L	12-h	Fibrous connective tissue	None
3025	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	28 % Cytotoxicity at 6.25 mg/L	12-h	Fibrous connective tissue	None
3023	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	95 % Cytotoxicity at 25 mg/L	12-h	Fibrous connective tissue	None
3021	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	30 % Cytotoxicity at 3.125 mg/L	6-h	Fibrous connective tissue	None
3022	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	97 % Cytotoxicity at 50 mg/L	12-h	Fibrous connective tissue	None
3020	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	30 % Cytotoxicity at 6.25 mg/L	6-h	Fibrous connective tissue	None
3019	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	30 % Cytotoxicity at 12.5 mg/L	6-h	Fibrous connective tissue	None
3018	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	90 % Cytotoxicity at 25 mg/L	6-h	Fibrous connective tissue	None
3017	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	90 % Cytotoxicity at 50 mg/L	6-h	Fibrous connective tissue	None
3016	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	35 % Cytotoxicity at 3.125 mg/L	3-h	Fibrous connective tissue	None
3015	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	35 % Cytotoxicity at 6.25 mg/L	3-h	Fibrous connective tissue	None
3014	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	40 % Cytotoxicity at 12.5 mg/L	3-h	Fibrous connective tissue	None
3013	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	82 % Cytotoxicity at 25 mg/L	3-h	Fibrous connective tissue	None
3012	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HT-1080	Fibrosarcoma	MTT/MTS assay	88 % Cytotoxicity at 50 mg/L	3-h	Fibrous connective tissue	None
3011	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	5 % Cytotoxicity at 3.125 mg/L	24-h	Cervix	None
3010	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	12 % Cytotoxicity at 6.25 mg/L	24-h	Cervix	None
3009	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	15 % Cytotoxicity at 12.5 mg/L	24-h	Cervix	None
3008	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	80 % Cytotoxicity at 25 mg/L	24-h	Cervix	None
3007	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	90 % Cytotoxicity at 50 mg/L	24-h	Cervix	None
3006	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	10 % Cytotoxicity at 3.125 mg/L	12-h	Cervix	None
3005	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	5 % Cytotoxicity at 6.25 mg/L	12-h	Cervix	None
3004	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	4 % Cytotoxicity at 12.5 mg/L	12-h	Cervix	None
3003	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	68 % Cytotoxicity at 25 mg/L	12-h	Cervix	None
3002	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	78 % Cytotoxicity at 50 mg/L	12-h	Cervix	None
3001	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	4 % Cytotoxicity at 3.125 mg/L	6-h	Cervix	None
3000	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	70 % Cytotoxicity at 25 mg/L	6-h	Cervix	None
2999	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	75 % Cytotoxicity at 50 mg/L	6-h	Cervix	None
2998	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	4 % Cytotoxicity at 12.5 mg/L	3-h	Cervix	None
2997	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	44 % Cytotoxicity at 25 mg/L	3-h	Cervix	None
2996	23598079	2013	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	Linear	L	None	Free	Free	Antimicrobial	Epinephelus nebulosus	HeLa	Cervical Cancer	MTT/MTS assay	62 % Cytotoxicity at 50 mg/L	3-h	Cervix	None
2924	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	COLO-587	Human epithelial Cancer	WST-1 assay	IC₅₀=6.4 µM	72-h	Pancreatic	None
2923	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	LNCaP	Prostate Cancer	WST-1 assay	IC₅₀= 6.2 µM	72-h	Prostate	None
2922	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	HuCCT-1	Human epithelial Cancer	WST-1 assay	IC₅₀= 8.3 µM	72-h	Bileduct	None
2921	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	U-251	Brain Tumor	WST-1 assay	IC₅₀=7.0 µM	72-h	Brain	None
2920	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	SN-19	Brain Tumor	WST-1 assay	IC₅₀= 7.8 µM	72-h	Brain	None
2919	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	SF-295	Brain Tumor	WST-1 assay	IC₅₀= 6.3 µM	72-h	Brain	None
2918	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	ZR75-1	Breast Cancer	WST-1 assay	IC₅₀= 9.3 µM	72-h	Breast	None
2917	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	BT-20	Breast Cancer	WST-1 assay	IC₅₀= 4.8 µM	72-h	Breast	None
2916	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	MDA-MB-231	Breast Cancer	WST-1 assay	IC₅₀= 7.8 µM	72-h	Breast	None
2915	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	SK-BR-3	Breast Cancer	WST-1 assay	IC₅₀= 6.5 µM	72-h	Breast	None
2914	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	T-47D	Breast Cancer	WST-1 assay	IC₅₀= 4.0 µM	72-h	Breast	None
2913	21849092	2011	THRPPMWSPVWPGGGKLlLKlLkkLLKlLKKK	Transferrin receptor (TfR)-lytic hybrid peptide	32	Linear	Mix	None	Free	Free	Anticancer	Transferrin receptor (TfR)	BT-474	Breast Cancer	WST-1 assay	IC₅₀= 8.8 µM	72-h	Breast	None
2868	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Interleukin-4 receptor a (IL-4Ra) chain	MDA-MB-231	Breast Cancer	WST-1 assay	IC₅₀=5.7 µMol/L	24-h	Breast	None
2867	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Interleukin-4 receptor a (IL-4Ra) chain	H-322	Lung Cancer	WST-1 assay	IC₅₀=3.6 µMol/L	24-h	Lung	None
2866	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Interleukin-4 receptor a (IL-4Ra) chain	A-172	Brain Tumor	WST-1 assay	IC₅₀=6.8 µMol/L	24-h	Brain	None
2865	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Interleukin-4 receptor a (IL-4Ra) chain	T98G	Brain Tumor	WST-1 assay	IC₅₀=18.5 µMol/L	24-h	Brain	None
2864	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Bovine lactoferrin (Lf-B)	KB	Oral Cancer	WST-1 assay	IC₅₀=13.2 µMol/L	24-h	Oral mucosa	None
2863	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Interleukin-4 receptor a (IL-4Ra) chain	SU.86.86	Pancreatic Cancer	WST-1 assay	IC₅₀=7.5 µMol/L	24-h	Pancreatic	None
2862	22084165	2011	KQLIRFLKRLDRNGGGKLlLKlLkkLLKlLKKK	IL-4RaÐlytic hybrid peptide	33	Linear	Mix	None	Free	Free	Anticancer	Interleukin-4 receptor a (IL-4Ra) chain	BXPC-3	Pancreatic Cancer	WST-1 assay	IC₅₀=6.8 µMol/L	24-h	Pancreatic	None
2850	23028527	2012	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Adenoregulin	33	Linear	L	None	Free	Free	Antimicrobial	South American frog Phyllomedusa bicolor	Raji	Lymphoma Cancer	LDH leakage assay	GI₅₀ =2.57±0.75 µM	24-h	Blood	None
2849	23028527	2012	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Adenoregulin	33	Linear	L	None	Free	Free	Antimicrobial	South American frog Phyllomedusa bicolor	MDA-MB-231	Breast Cancer	LDH leakage assay	GI₅₀ =8.06±0.50 µM	24-h	Breast	None
2848	23028527	2012	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Adenoregulin	33	Linear	L	None	Free	Free	Antimicrobial	South American frog Phyllomedusa bicolor	DU-145	Liver Cancer	LDH leakage assay	GI₅₀ =0.91±0.04 µM	24-h	Prostate	None
2847	23028527	2012	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Adenoregulin	33	Linear	L	None	Free	Free	Antimicrobial	South American frog Phyllomedusa bicolor	LNCaP	Prostate Cancer	LDH leakage assay	GI₅₀ =0.31±0.15 µM	24-h	Prostate	None
2846	23028527	2012	GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAV	Adenoregulin	33	Linear	L	None	Free	Free	Antimicrobial	South American frog Phyllomedusa bicolor	PC-3	Prostate Cancer	LDH leakage assay	GI₅₀ =1.24±0.23 µM	24-h	Prostate	None
2808	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	HeLa	Cervical Cancer	MTT/MTS assay	LD₅₀ =250 µg/ml	24-h	Cervix	US_06875744_B2
2727	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	HeLa	Cervical Cancer	MTT/MTS assay	LD₅₀ =175 µg/ml	24-h	Cervix	US_06875744_B2
2670	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	HeLa	Cervical Cancer	MTT/MTS assay	LD₅₀ =>1000 µg/ml	24-h	Cervix	US_06875744_B2
2669	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	HeLa	Cervical Cancer	MTT/MTS assay	LD₅₀ =150 µg/ml	24-h	Cervix	US_06875744_B2
2665	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	PC-3	Prostate Cancer	MTT/MTS assay	LD₅₀ =370 µg/ml	24-h	Prostate	US_06875744_B2
2584	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	PC-3	Prostate Cancer	MTT/MTS assay	LD₅₀ =52 µg/ml	24-h	Prostate	US_06875744_B2
2526	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	PC-3	Prostate Cancer	MTT/MTS assay	Not Available	24-h	Prostate	US_06875744_B2
2527	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	PC-3	Prostate Cancer	MTT/MTS assay	LD₅₀ =630 µg/ml	24-h	Prostate	US_06875744_B2
2522	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	H-1299	Lung Cancer	MTT/MTS assay	LD₅₀ =120 µg/ml	24-h	Lung	US_06875744_B2
2441	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	H-1299	Lung Cancer	MTT/MTS assay	LD₅₀ =53 µg/ml	24-h	Lung	US_06875744_B2
2384	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	H-1299	Lung Cancer	MTT/MTS assay	LD₅₀ =720 µg/ml	24-h	Lung	US_06875744_B2
2383	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	H-1299	Lung Cancer	MTT/MTS assay	LD₅₀ =220 µg/ml	24-h	Lung	US_06875744_B2
2369	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =170 µg/ml	24-h	Skin	US_06875744_B2
2288	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =94 µg/ml	24-h	Skin	US_06875744_B2
2231	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =120 µg/ml	24-h	Skin	US_06875744_B2
2232	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =>1000 µg/ml	24-h	Skin	US_06875744_B2
2217	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =170 µg/ml	24-h	Skin	US_06875744_B2
2136	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =94 µg/ml	24-h	Skin	US_06875744_B2
2080	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =>1000 µg/ml	24-h	Skin	US_06875744_B2
2079	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	BMKC	Skin Cancer	MTT/MTS assay	LD₅₀ =120 µg/ml	24-h	Skin	US_06875744_B2
2065	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	SW-480	Colon Cancer	MTT/MTS assay	LD₅₀ =240 µg/ml	24-h	Colon	US_06875744_B2
1984	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	SW-480	Colon Cancer	MTT/MTS assay	LD₅₀ =125 µg/ml	24-h	Colon	US_06875744_B2
1928	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	SW-480	Colon Cancer	MTT/MTS assay	LD₅₀ =>1000 µg/ml	24-h	Colon	US_06875744_B2
1927	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	SW-480	Colon Cancer	MTT/MTS assay	LD₅₀ =82 µg/ml	24-h	Colon	US_06875744_B2
1913	None	2005	LPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	LSB-37	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	MCF-7	Breast Cancer	MTT/MTS assay	LD₅₀ =50 µg/ml	24-h	Breast	US_06875744_B2
1832	None	2005	FAKKLAKKLKKLAKKLAKLALALKALALKAL	Shiva-11	31	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	MCF-7	Breast Cancer	MTT/MTS assay	LD₅₀ =96 µg/ml	24-h	Breast	US_06875744_B2
1776	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AM	38	Linear	L	None	Amidation	Free	Anticancer	FLAK peptides	MCF-7	Breast Cancer	MTT/MTS assay	LD₅₀ =540 µg/ml	24-h	Breast	US_06875744_B2
1775	None	2005	MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG	SB-37 AC	38	Linear	L	None	Free	Free	Anticancer	FLAK peptides	MCF-7	Breast Cancer	MTT/MTS assay	LD₅₀ =175 µg/ml	24-h	Breast	US_06875744_B2
1708	9614066	1998	ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ	DRS S1	35	Linear	L	None	Free	Free	Antimicrobial	Dermaseptins B	MCF-7	Breast Cancer	Thymidine Incorporation assay	Not Available	6-h	Breast	None
1546	22073006	2011	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	Linear	L	None	Free	Free	Antibacterial	Red Sea Mosessole	HT-1080	Fibrosarcoma	MTT/MTS assay	IC₅₀=14.52 µg/ml	24-h	Fibrous connective tissue	None
1545	22073006	2011	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	Linear	L	None	Free	Free	Antibacterial	Red Sea Mosessole	HT-1080	Fibrosarcoma	MTT/MTS assay	IC₅₀=14.51 µg/ml	12-h	Fibrous connective tissue	None
1544	22073006	2011	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	Linear	L	None	Free	Free	Antibacterial	Red Sea Mosessole	HT-1080	Fibrosarcoma	MTT/MTS assay	IC₅₀=15.40 µg/ml	6-h	Not Available	None
1543	22073006	2011	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	Linear	L	None	Free	Free	Antibacterial	Red Sea Mosessole	HT-1080	Fibrosarcoma	MTT/MTS assay	IC₅₀=15.74 µg/ml	3-h	Not Available	None
1351	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	J82	Bladder Cancer	LDH leakage assay	Cytotoxicity=196.3 µg/ml	48-h	Bladder	None
1349	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	647V	Bladder Cancer	LDH leakage assay	IC₅₀=181.1 µg/ml	48-h	Bladder	None
1348	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	RT4	Bladder Cancer	LDH leakage assay	IC₅₀=240.4 µg/ml	48-h	Bladder	None
1347	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	486P	Bladder Cancer	LDH leakage assay	IC₅₀=232.4 µg/ml	48-h	Bladder	None
1344	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	J82	Bladder Cancer	LDH leakage assay	IC₅₀=319.2 µg/ml	48-h	Bladder	None
1343	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	647V	Bladder Cancer	LDH leakage assay	IC₅₀=200.7 µg/ml	48-h	Bladder	None
1342	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	RT4	Bladder Cancer	LDH leakage assay	IC₅₀=289.3 µg/ml	48-h	Bladder	None
1341	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	486P	Bladder Cancer	LDH leakage assay	IC₅₀=373.3/ µg/ml	48-h	Bladder	None
1338	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	J82	Bladder Cancer	Cell Viability assay	IC₅₀=77.51 µg/ml	48-h	Bladder	None
1337	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	647V	Bladder Cancer	Cell Viability assay	IC₅₀=61.86 µg/ml	48-h	Bladder	None
1336	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	RT4	Bladder Cancer	Cell Viability assay	IC₅₀=92.9 µg/ml	48-h	Bladder	None
1335	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	486P	Bladder Cancer	Cell Viability assay	IC₅₀=87.47 µg/ml	48-h	Bladder	None
1332	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	J82	Bladder Cancer	Cell Viability assay	IC₅₀=99.01 µg/ml	48-h	Bladder	None
1331	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	647V	Bladder Cancer	Cell Viability assay	IC₅₀=28.74 µg/ml	48-h	Bladder	None
1330	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	RT4	Bladder Cancer	Cell Viability assay	IC₅₀=96.22 µg/ml	48-h	Bladder	None
1329	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	486P	Bladder Cancer	Cell Viability assay	IC₅₀=69.2 µg/ml	48-h	Bladder	None
1326	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	J82	Bladder Cancer	WST-1 assay	IC₅₀=97.93 µg/ml	48-h	Bladder	None
1325	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	647V	Bladder Cancer	WST-1 assay	IC₅₀=115.12 µg/ml	48-h	Bladder	None
1324	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	RT4	Bladder Cancer	WST-1 assay	IC₅₀=184.81 µg/ml	48-h	Bladder	None
1323	18315881	2008	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antimicrobial	Chinese oak silk moth	486P	Bladder Cancer	WST-1 assay	IC₅₀=161.76 µg/ml	48-h	Bladder	None
1320	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	J82	Bladder Cancer	WST-1 assay	IC₅₀=212.07 µg/ml	48-h	Bladder	None
1319	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	647V	Bladder Cancer	WST-1 assay	IC₅₀=185.39 µg/ml	48-h	Bladder	None
1318	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	RT4	Bladder Cancer	WST-1 assay	IC₅₀=231.26 µg/ml	48-h	Bladder	None
1317	18315881	2008	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK	Cecropin A	37	Linear	L	None	Amidation	Free	Antimicrobial	Hyalophora Cecropia(silkmoth)	486P	Bladder Cancer	WST-1 assay	IC₅₀=251.47 µg/ml	48-h	Bladder	None
1251	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	MCF-7R	Breast Cancer	MTT assay	IC₅₀=24.5	96-h	Breast	None
1250	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	A-2780R	Ovarian Cancer	MTT assay	IC₅₀=34.5	96-h	Ovary	None
1249	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	HT-29	Colon Cancer	MTT assay	IC₅₀=>100 µM	96-h	Colon	None
1248	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	MCF-7	Breast Cancer	MTT assay	IC₅₀=42.5 µM	96-h	Breast	None
1247	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	MAC15A	Colon Cancer	MTT assay	IC₅₀=37 µM	96-h	Colon	None
1246	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	CHO-KI	Ovarian Cancer	MTT assay	IC₅₀=32 µM	96-h	Ovary	None
1245	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	HCLO	Colon Cancer	MTT assay	IC₅₀=33.5 µM	96-h	Colon	None
1244	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	A-2780	Ovarian Cancer	MTT assay	IC₅₀=30.6 µM	96-h	Ovary	None
1243	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	WEHI-3B	Leukemia Cancer	MTT assay	IC₅₀=4.4 µM	96-h	Blood	None
1242	7849420	1994	MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG	Shiva-1	38	Linear	L	None	Free	Free	Antibacterial	Magainin	DLD-1	Colon Cancer	MTT assay	IC₅₀=>100 µM	96-h	Colon	None
1241	7849420	1994	MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG	Shiva-1	38	Linear	L	None	Free	Free	Antibacterial	Magainin	HRT-18	Colon Cancer	MTT assay	IC₅₀=49.3 µM	96-h	Colon	None
1240	7849420	1994	MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG	Shiva-1	38	Linear	L	None	Free	Free	Antibacterial	Magainin	BTS-30	Breast Cancer	MTT assay	IC₅₀=56 µM	96-h	Breast	None
1239	7849420	1994	MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG	Shiva-1	38	Linear	L	None	Free	Free	Antibacterial	Magainin	K-562	Leukemia Cancer	MTT assay	IC₅₀=28.7 µM	96-h	Blood	None
1238	7849420	1994	SWLSKTAKKLENSAKKRISEGIAIAIQGGPR	Cecropin P1	31	Linear	L	None	Free	Free	Antibacterial	Small Intestine of Pig	DLD-1	Colon Cancer	MTT assay	IC₅₀=>100 µM	96-h	Colon	None
1237	7849420	1994	SWLSKTAKKLENSAKKRISEGIAIAIQGGPR	Cecropin P1	31	Linear	L	None	Free	Free	Antibacterial	Small Intestine of Pig	HRT-18	Colon Cancer	MTT assay	IC₅₀=>100 µM	96-h	Colon	None
1236	7849420	1994	SWLSKTAKKLENSAKKRISEGIAIAIQGGPR	Cecropin P1	31	Linear	L	None	Free	Free	Antibacterial	Small Intestine of Pig	BTS-30	Breast Cancer	MTT assay	IC₅₀=>100 µM	96-h	Breast	None
1235	7849420	1994	SWLSKTAKKLENSAKKRISEGIAIAIQGGPR	Cecropin P1	31	Linear	L	None	Free	Free	Antibacterial	Small Intestine of Pig	K-562	Leukemia Cancer	MTT assay	IC₅₀=93 µM	96-h	Blood	None
1234	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	DLD-1	Colon Cancer	MTT assay	IC₅₀=>100 µM	96-h	Colon	None
1233	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	HRT-18	Colon Cancer	MTT assay	IC₅₀=25.5 µM	96-h	Colon	None
1232	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	BTS-30	Breast Cancer	MTT assay	IC₅₀=24.8 µM	96-h	Breast	None
1231	7849420	1994	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	Linear	L	None	Amidation	Free	Antibacterial	Hyalophora Cecropia(silkmoth)	K-562	Leukemia Cancer	MTT assay	IC₅₀=15.5 µM	96-h	Blood	None
7740	None	2019	RQIKIWFQNRRMKWKKRQRRNDLRSSFLTLRDHVP	IDP-NLCa02	35	Linear	L	None	Free	Free	Anticancer	Synthetic	RG1	Glioblastoma	AlamarBlue assay	EC₅₀ ~ 5 μM	72-96 h	Brain	WO 2019/025432 Al
7757	None	2020	RQIKWFQNRRMKWKKSKAPKVVILSKALEYLQA	IDP-LLCb02	33	Linear	L	None	Free	Free	Anticancer	Synthetic	NCl-H187	Lung Cancer	MTT/Alamamar-Blue/Hexosaminidase activity test	EC₅₀ ~ 7.5 μM	48-72 h	Lung	US20200239547A1
7758	None	2020	RQIKWFQNRRMKWKKSKAPKVVILSKALEYLQA	IDP-LLCb02	33	Linear	L	None	Free	Free	Anticancer	Synthetic	NCl-H82	Lung Cancer	MTT/Alamamar-Blue/Hexosaminidase activity test	EC₅₀ ~ 10 μM	48-72 h	Lung	US20200239547A1
7759	None	2020	RQIKWFQNRRMKWKKSKAPKVVILSKALEYLQA	IDP-LLCb02	33	Linear	L	None	Free	Free	Anticancer	Synthetic	NCl-H510A	Lung Cancer	MTT/Alamamar-Blue/Hexosaminidase activity test	EC₅₀ ~ 15 μM	48-72 h	Lung	US20200239547A1
7816	None	2022	LTSVVFILICCFHLENIFVLLKKRTLRKNDRKKR	Sample Peptide 1 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 48% at 25 μM	48-h	Kidney	US011339203B2
7817	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 0.4% at 25 μM	48-h	Kidney	US011339203B2
7818	None	2022	WFLREGSMFVALSASVFSLLAIKKRTLRKNDRKKR	Sample Peptide 3 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 45.8% at 25 μM	48-h	Kidney	US011339203B2
7819	None	2022	FLLISACWVISLILGGLPIMGWKKRTLRKNDRKKR	Sample Peptide 4 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 85.6% at 25 μM	48-h	Kidney	US011339203B2
7821	None	2022	VIIVLSVFIACWAPLFILLLLKKRTLRKNDRKKR	Sample Peptide 6 from US011339203B2	34	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 59.7% at 25 μM	48-h	Kidney	US011339203B2
7822	None	2022	LFRAEYFLVLAVLNSGTNPIIKKRTLRKNDRKKR	Sample Peptide 7 from US011339203B2	34	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 66.3% at 25 μM	48-h	Kidney	US011339203B2
7823	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	PC-3	Prostate Cancer	CCK-8 assay	Cell Viability = 2.5% at 25 μM	48-h	Kidney	US011339203B2
7824	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-2058	Skin Cancer	CCK-8 assay	Cell Viability = 0.2% at 25 μM	48-h	Skin	US011339203B2
7825	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 assay	Cell Viability = 0.6% at 25 μM	48-h	Lung	US011339203B2
7826	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-549	Lung Cancer	CCK-8 assay	Cell Viability = 1.4% at 25 μM	48-h	Lung	US011339203B2
7827	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 / WST-8	Cell Viability = 6.8% at 25 μM	48-h	Lung	EP3604345B1;US11352408B2
7829	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 / WST-8	Cell Viability = 87.7% at 25 μM	48-h	Lung	EP3604345B1
7830	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 11.8% at 25 μM	48-h	Lung	EP3604345B1
7832	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 120.6% at 25 μM	48-h	Lung	EP3604345B1
7833	None	2023	PWWWPPVVVQQQMILLIGAARKKRTLRKNDRKKR	Sample Peptide 4 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 102.6% at 25 μM	48-h	Lung	EP3604345B1
7836	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H446	Lung Cancer	CCK-8 / WST-8	Cell Viability = 0.5% at 25 μM	48-h	Lung	EP3604345B1
7837	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H446	Lung Cancer	CCK-8 / WST-8	Cell Viability = 56.7% at 25 μM	48-h	Lung	EP3604345B1
7838	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-2058	Skin Cancer	CCK-8 / WST-8	Cell Viability = 6.7% at 25 μM	48-h	Skin	EP3604345B1
7839	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-2058	Skin Cancer	CCK-8 / WST-8	Cell Viability = 87.5% at 25 μM	48-h	Skin	EP3604345B1
7840	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	CCK-8 / WST-8	Cell Viability = 62.3% at 25 μM	48-h	Breast	EP3604345B1
7841	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	CCK-8 / WST-8	Cell Viability = 81.7% at 25 μM	48-h	Breast	EP3604345B1