CancerPPD 2.0 - Year of Publication

Browsing Year-wise

Browse Results:

Filter by Length
Minimum Length
Maximum Length

ID	PMID	YEAR	Sequence	Name	Length	Linear/Cyclic	Chirality	Chem-MOD	C-ter MOD	N-ter MOD	Nature	Origin	Cell Line	Cancer Type	Assay	Activity	Testing Time	Tissue Affected	Patents
7713	38319435	2024	FFFLSRIF	Temporin-SHf	8	Linear	L	None	Amidation	Free	Antimicrobial	Pelophylax saharica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 32.64 ± 1.350 µM	24-h	Liver	None
7714	None	2022	RRWKRFFKRWKGGVIGVTFPF	ATRA1-R3W2 - HYD	21	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	H-358	Lung Cancer	Cytotoxicity assay	LD₅₀ ~24.5 μM	6-h	Lung	US011447533B2
7712	38319435	2024	FFFLSRIF	Temporin-SHf	8	Linear	L	None	Amidation	Free	Antimicrobial	Pelophylax saharica	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 36.67 ± 0.729 µM	24-h	Prostate	None
7711	38319435	2024	FFFLSRIF	Temporin-SHf	8	Linear	L	None	Amidation	Free	Antimicrobial	Pelophylax saharica	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 32.76 ± 1.528 µM	24-h	Breast	None
7710	38319435	2024	FFFLSRIF	Temporin-SHf	8	Linear	L	None	Amidation	Free	Antimicrobial	Pelophylax saharica	A-549	Lung Cancer	MTT assay	IC₅₀ = 24.03 ± 0.945 µM	24-h	Lung	None
7709	37853814	2024	RWGKWFKKATHVGKHVGKAALTAYL	NRC-07	25	Linear	L	None	Free	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	52.5 ± 5.0% cell viability at 150 µM	24-h	Breast	None
7708	37853814	2024	RWGKWFKKATHVGKHVGKAALTAYL	NRC-07	25	Linear	L	None	Free	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	14.0 ± 3.0% cell viability at 150 µM	24-h	Breast	None
7704	38491556	2024	AAEKEFIKYPYPTPLQYQQLATRLKVEKKLVRRW	HMM-ID	34	Linear	L	None	Free	Free	Anticancer	Red Sea Brine	U2OS	Osteosarcoma	MTT assay	IC₅₀ = 100.5 µg/ml	24-h	Bone	None
7702	38272230	2024	RPPLVIC	RP7 SCR	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 128 ± 11.65 µM	24-h	Prostate	None
7703	38272230	2024	RPPLVIC	RP7 SCR	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	DU-145	Prostate Cancer	MTT assay	IC₅₀ = 137 ± 5.98 µM	24-h	Prostate	None
7701	38272230	2024	RPPLVIC	RP7 SCR	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 150 ± 10.32 µM	24-h	Breast	None
7700	38272230	2024	RPPLVIC	RP7 SCR	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 156 ± 8.15 µM	24-h	Breast	None
7699	38272230	2024	rppcvil	D-RP-7	7	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	DU-145	Prostate Cancer	MTT assay	IC₅₀ = 121.59 ± 6.56 µM	24-h	Prostate	None
7698	38272230	2024	rppcvil	D-RP-7	7	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 101 ± 5.73 µM	24-h	Prostate	None
7696	38272230	2024	rppcvil	D-RP-7	7	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 95 ± 7.71 µM	24-h	Breast	None
7697	38272230	2024	rppcvil	D-RP-7	7	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 90 ± 10.31 µM	24-h	Breast	None
7694	38272230	2024	RPPCVIL	RP-7	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 113 ± 8.02 µM	24-h	Prostate	None
7695	38272230	2024	RPPCVIL	RP-7	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	DU-145	Prostate Cancer	MTT assay	IC₅₀ = 120.72 ± 7.08 µM	24-h	Prostate	None
7693	38272230	2024	RPPCVIL	RP-7	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 110.12 ± 4.23 µM	24-h	Breast	None
7691	38272230	2024	LAKAVI	LA3IK-SCR	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	DU-145	Prostate Cancer	MTT assay	IC₅₀ = 351.76 ± 7.18 µM	24-h	Prostate	None
7692	38272230	2024	RPPCVIL	RP-7	7	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 139.03 ± 8.41 µM	24-h	Breast	None
7690	38272230	2024	LAKAVI	LA3IK-SCR	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 319 ± 13.64 µM	24-h	Prostate	None
7689	38272230	2024	LAKAVI	LA3IK-SCR	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 133 ± 9.52 µM	24-h	Breast	None
7688	38272230	2024	LAKAVI	LA3IK-SCR	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 243 ± 8.16 µM	24-h	Breast	None
7686	38272230	2024	laiavk	D-LA3IK	6	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 98.71 ± 6.17 µM	24-h	Prostate	None
7687	38272230	2024	laiavk	D-LA3IK	6	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	DU-145	Prostate Cancer	MTT assay	IC₅₀ = 89.11 ± 8.12 µM	24-h	Prostate	None
7685	38272230	2024	laiavk	D-LA3IK	6	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 91.2 ± 8.21 µM	24-h	Breast	None
7683	38272230	2024	LAIAVK	LA3IK	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	DU-145	Prostate Cancer	MTT assay	IC₅₀ = 335.7 ± 3.09 µM	24-h	Prostate	None
7684	38272230	2024	laiavk	D-LA3IK	6	Linear	D	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 197.72 ± 5.42 µM	24-h	Breast	None
7681	38272230	2024	LAIAVK	LA3IK	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 90.23 ± 7.32 µM	24-h	Breast	None
7682	38272230	2024	LAIAVK	LA3IK	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 321.4 ± 11.79 µM	24-h	Prostate	None
7680	38272230	2024	LAIAVK	LA3IK	6	Linear	L	None	Amidation	Acetylation	Anticancer	Migration and invasion enhancer 1 (MIEN1)	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 223.6 ± 5.62 µM	24-h	Breast	None
7675	38464729	2024	NCSIHGDIPAY	U7	11	Linear	L	None	Free	Free	Anticancer	Phoenix dactylifera	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 523 µM	48-h	Liver	None
7673	38464729	2024	NCSIHGDIPAY	U7	11	Linear	L	None	Free	Free	Anticancer	Phoenix dactylifera	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 554 µM	48-h	Breast	None
7674	38464729	2024	NCSIHGDIPAY	U7	11	Linear	L	None	Free	Free	Anticancer	Phoenix dactylifera	T-47D	Breast Cancer	MTT assay	IC₅₀ = 584 ± 29.99 µM	48-h	Breast	None
7666	38464729	2024	NGSIPATWASL	U3	11	Linear	L	None	Free	Free	Anticancer	Phoenix dactylifera	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 561 µM	48-h	Liver	None
7665	38464729	2024	NGSIPATWASL	U3	11	Linear	L	None	Free	Free	Anticancer	Phoenix dactylifera	T-47D	Breast Cancer	MTT assay	IC₅₀ = 517.6 ± 34.86 µM	48-h	Breast	None
7664	38464729	2024	NGSIPATWASL	U3	11	Linear	L	None	Free	Free	Anticancer	Phoenix dactylifera	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 555 µM	48-h	Breast	None
7658	37298595	2023	PEGKRPY-Tle-L	NT-12	9	Linear	L	Tle = L-tert-leucine	Free	Free	Anticancer	Synthetic analogue of Neurotensin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7659	37298595	2023	PEGKKPY-Tle-L	NT-12	9	Linear	L	Tle = L-tert-leucine	Free	Free	Anticancer	Synthetic analogue of Neurotensin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7656	37298595	2023	RRPYAL	NT-11	6	Linear	L	None	Free	Free	Anticancer	Synthetic analogue of Neurotensin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7657	37298595	2023	PEGRKPY-Tle-L	NT-12	9	Linear	L	Tle = L-tert-leucine	Free	Free	Anticancer	Synthetic analogue of Neurotensin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7654	37298595	2023	RRPYIL	NT-9	6	Linear	L	None	Free	Free	Anticancer	Synthetic analogue of Neurotensin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7655	37298595	2023	RRPAIL	NT-10	6	Linear	L	None	Free	Free	Anticancer	Synthetic analogue of Neurotensin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7652	37298595	2023	rRP-Hyp-G-Thi-S-(D)Pip-Thi-R	BK-7	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; (D)Pip—(D)-piperidine-2-carboxylic acid	Free	Free	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7653	37298595	2023	Aaa-rRP-Hyp-G-Thi-S-(D)Pip-Thi-R	BK-8	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; (D)Pip—(D)-piperidine-2-carboxylic acid	Free	Aaa = [(3S,5S,7S)-adamantan-1-yl]acetic acid	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7650	37298595	2023	rRP-Hyp-G-Thi-S-f-(L)Pip-R	BK-5	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; (L)Pip—(L)-piperidine-2-carboxylic acid	Free	Free	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7651	37298595	2023	Aaa-rRP-Hyp-G-Thi-S-(D)Pip-(L)Pip-R	BK-6	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; (L)Pip—(L)-piperidine-2-carboxylic acid;(D)Pip—(D)-piperidine-2-carboxylic acid	Free	Aaa = [(3S,5S,7S)-adamantan-1-yl]acetic acid	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7648	37298595	2023	Aaa-rRP-Hyp-G-Thi-S-Acc-Thi-R	BK-3	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; Acc = 1-aminocyclohexane-1-carboxylic acid	Free	Aaa = [(3S,5S,7S)-adamantan-1-yl]acetic acid	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7649	37298595	2023	Aaa-rRP-Hyp-G-Thi-S-f-Acc-R	BK-4	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; Acc = 1-aminocyclohexane-1-carboxylic acid	Free	Aaa = [(3S,5S,7S)-adamantan-1-yl]acetic acid	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7646	37298595	2023	rRP-Hyp-G-Thi-S-Apc-Thi-R	BK-1	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; Apc =1-aminocyclopentyl-1-carboxylic acid	Free	Free	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7647	37298595	2023	rRP-Hyp-G-Thi-S-f-Apc-R	BK-2	10	Linear	Mix	Hyp = hydroxyproline; Thi = thienylalanine; Apc =1-aminocyclopentyl-1-carboxylic acid	Free	Free	Anticancer	Synthetic analogue of Bradykinin	HCT-116	Colorectal Cancer	MTS assay	Not Available	24-h	Colon	None
7645	37344820	2023	AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA	Moricin	43	Linear	L	None	Free	Free	Antimicrobial	Bombyx mori	MDA-MB-231	Triple-negative Breast Cancer	Trypan blue assay	70% cell viability at 6.25 µg/ml	24-h	Breast	None
7644	37344820	2023	AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA	Moricin	43	Linear	L	None	Free	Free	Antimicrobial	Bombyx mori	MDA-MB-231	Triple-negative Breast Cancer	LDH release assay	Significant decrease in cell viability at 6.25 μg/ml	24-h	Breast	None
7642	37880286	2023	GIGAVLKVLTTGLPALISWIKRKRQQC	MC–FA	27	Linear	L	None	Folic Acid	Free	Anticancer; Antibacterial	Synthetic analogue	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 12.63 µg/mL	24-h	Breast	None
7643	37344820	2023	AKIPIKAAIKTVGKAVGKGLRAINIASTANDVFNFLKPKKRKA	Moricin	43	Linear	L	None	Free	Free	Antimicrobial	Bombyx mori	MDA-MB-231	Triple-negative Breast Cancer	MTT assay	70% cell viability at 6.25 µg/ml	24-h	Breast	None
7640	37880286	2023	GIGAVLKVLTTGLPALISWIKRKRQQC	MC–FA	27	Linear	L	None	Folic Acid	Free	Anticancer; Antibacterial	Synthetic analogue	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 66.43 µg/mL	24-h	Cervix	None
7641	37880286	2023	GIGAVLKVLTTGLPALISWIKRKRQQC	MC–FA	27	Linear	L	None	Folic Acid	Free	Anticancer; Antibacterial	Synthetic analogue	C-33A	Cervical Cancer	MTT assay	IC₅₀ = 35.22 µg/ mL	24-h	Cervix	None
7638	37880286	2023	CGIGAVLKVLTTGLPALISWIKRKRQQ	CM–FA	27	Linear	L	None	Amidation	Folic Acid	Anticancer; Antibacterial	Synthetic analogue	C-33A	Cervical Cancer	MTT assay	IC₅₀ = 35.75 µg/mL	24-h	Cervix	None
7639	37880286	2023	CGIGAVLKVLTTGLPALISWIKRKRQQ	CM–FA	27	Linear	L	None	Amidation	Folic Acid	Anticancer; Antibacterial	Synthetic analogue	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 10.38 µg/mL	24-h	Breast	None
7637	37880286	2023	CGIGAVLKVLTTGLPALISWIKRKRQQ	CM–FA	27	Linear	L	None	Amidation	Folic Acid	Anticancer; Antibacterial	Synthetic analogue	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 67.34 µg/mL	24-h	Cervix	None
7636	37880286	2023	GIGAVLKVLTTGLPALISWIKRKRQQC	Mel-C	27	Linear	L	None	Amidation	Free	Anticancer; Antibacterial	Synthetic analogue	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 160.62 µg/mL	24-h	Breast	None
7635	37880286	2023	GIGAVLKVLTTGLPALISWIKRKRQQC	Mel-C	27	Linear	L	None	Amidation	Free	Anticancer; Antibacterial	Synthetic analogue	C-33A	Cervical Cancer	MTT assay	IC₅₀ = 58.63 µg/mL	24-h	Cervix	None
7634	37880286	2023	GIGAVLKVLTTGLPALISWIKRKRQQC	Mel-C	27	Linear	L	None	Amidation	Free	Anticancer; Antibacterial	Synthetic analogue	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 50.72 µg/mL	24-h	Cervix	None
7633	37880286	2023	CGIGAVLKVLTTGLPALISWIKRKRQQ	C-Mel	27	Linear	L	None	Amidation	Free	Anticancer; Antibacterial	Synthetic analogue	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 110.59 µg/mL	24-h	Breast	None
7632	37880286	2023	CGIGAVLKVLTTGLPALISWIKRKRQQ	C-Mel	27	Linear	L	None	Amidation	Free	Anticancer; Antibacterial	Synthetic analogue	C-33A	Cervical Cancer	MTT assay	IC₅₀ = 44.76 µg/mL	24-h	Cervix	None
7631	37880286	2023	CGIGAVLKVLTTGLPALISWIKRKRQQ	C-Mel	27	Linear	L	None	Amidation	Free	Anticancer; Antibacterial	Synthetic analogue	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 64.15 µg/mL	24-h	Cervix	None
7629	37251837	2023	Not Available	CPSA-CPSC-L-ACAN	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	Anticancer	Recombinant Fusion Peptide	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 63.15 μg/ml	24-h	Cervix	None
7628	36873017	2023	CLKKLLKLLKKLLKLCLEELLHHLEELLHH	LK-LE3	30	Cyclic	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 10.2 µM at pH 6	24-h	Cervix	None
7627	36873017	2023	CLKKLLKLLKKLLKLCLEHLLEHLEHLLEH	LK-LE2	30	Cyclic	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 12.9 µM at pH 6	24-h	Cervix	None
7626	36873017	2023	CLKKLLKLLKKLLKLCLHELLEHLHELLEH	LK-LE1	30	Cyclic(C1-C16)	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 11.3 µM at pH 6	24-h	Cervix	None
7624	37104235	2023	QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT	LHRH-BinBC	195	Linear	L	None	Free	Fused a luteinizing hormone-releasing hormone (LHRH) peptide	Mosquitocidal, Anticancer	Synthetic	MCF-7	Breast Cancer	LDH leakage assay	40% LDH efflux at 16 µM	48-h	Breast	None
7623	37104235	2023	QHWSYGLRPGGRGPKDAVRAVKGSALLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMYFYLRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRMAGIQSYPNAPITNPLTLT	LHRH-BinBC	195	Linear	L	None	Free	Fused a luteinizing hormone-releasing hormone (LHRH) peptide	Mosquitocidal, Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 10.96 μM	48-h	Breast	None
7622	37001908	2023	EYVQTVKSSKG	A11	11	Linear	L	None	Free	Free	Anticancer	Annexin A1	A-375	Skin Cancer	Biotin Pull Down assay	Not Available	24-h	Skin	None
7620	37001908	2023	EYVQTVKSSKG	A11	11	Linear	L	None	Free	Free	Anticancer	Annexin A1	MDA-MB-231	Breast Cancer	Biotin Pull Down assay	Not Available	24-h	Breast	None
7621	37001908	2023	EYVQTVKSSKG	A11	11	Linear	L	None	Free	Free	Anticancer	Annexin A1	H-460	Lung Cancer	Biotin Pull Down assay	Not Available	24-h	Lung	None
7618	36934526	2023	RLLRLLRLRRLLRL	WP2	14	Linear	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	HepG-2	Liver Cancer	Cell Viability assay	IC₅₀ = 34.05 ± 0.53 μM	48-h	Liver	None
7619	36934526	2023	RLLRLLRLRRLLRL	WP2	14	Linear	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	HT-29	Colon Cancer	Cell Viability assay	IC₅₀ = 42.6 ± 4.0 μM	48-h	Colon	None
7616	36934526	2023	RLLRLLRLRRLLRL	WP2	14	Linear	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	HeLa	Cervical Cancer	HDAC inhibition assay	IC₅₀ = 0.446±0.095 µM	Not Available	Cervix	None
7617	36934526	2023	RLLRLLRLRRLLRL	WP2	14	Linear	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	Huh-7	Liver Cancer	Cell Viability assay	IC₅₀ = 28.12 ± 1.5 μM	48-h	Liver	None
7613	36934526	2023	RLLRLMRLRMLLRM	WP1	14	Cyclic(M6-M10)	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	Huh-7	Liver Cancer	Cell Viability assay	IC₅₀ = 43.74 ± 5.4 μM	48-h	Liver	None
7614	36934526	2023	RLLRLMRLRMLLRM	WP1	14	Cyclic(M6-M10)	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	HepG-2	Liver Cancer	Cell Viability assay	IC₅₀ = 52.23 ± 0.9 μM	48-h	Liver	None
7615	36934526	2023	RLLRLMRLRMLLRM	WP1	14	Cyclic(M6-M10)	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	HT-29	Colon Cancer	Cell Viability assay	IC₅₀ = 54.6 ± 2.1 μM	48-h	Colon	None
7612	36934526	2023	RLLRLMRLRMLLRM	WP1	14	Cyclic(M6-M10)	L	None	Hydroxamic acid	Acetylation	Anticancer	Derived from RLL peptide	HeLa	Cervical Cancer	HDAC inhibition assay	IC₅₀ = 0.310±0.064 µM	Not Available	Cervix	None
7611	37734650	2023	KLKSKLMVVANKIGLLKSLARKFVKSH	NKL-MUT	27	Linear	L	None	Free	Free	Antimicrobial	Trematomus bernacchii	B16-F10	Skin Cancer	luciferase-based ATPlite assay	ATP level = 0.023 ± 0.007 at 40 μM	12-h	Skin	None
7609	34986732	2023	trans(P)PIPYPIF	trans-Phakellistatin 18	7	Cyclic	L	Proline residues in trans-configuration	Free	Free	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 67.5 ± 2.938 µM	Not Available	Liver	None
7610	37734650	2023	KLKSKLMVVCNKIGLLKSLCRKFVKSH	NKL-WT	27	Linear	L	None	Free	Free	Antimicrobial	Trematomus bernacchii	B16-F10	Skin Cancer	luciferase-based ATPlite assay	ATP level = 0.753 ± 0.254 at 40 μM	12-h	Skin	None
7608	36840453	2023	FLKSLWRGVKAIFNGARQGYKEHKN	AMP-WF3	25	Linear	L	None	Free	Free	Anticancer	Poecilia Mexicana fish	Jurkat	Blood Cancer	MTT assay	IC₅₀ = 50 µM	24-h	Blood	None
7607	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	HCT-116	Colon Cancer	LDH leakage assay	LDH release above 80%	24-h	Colon	None
7606	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 2.02 μM	24-h	Colon	None
7605	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 2.32 μM	24-h	Brain	None
7604	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	MDA-MB-435	Breast Cancer	MTT assay	IC₅₀ = 18.99 μM	24-h	Breast	None
7603	31234333	2023	GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC	LFB	33	Linear	L	None	Free	Free	Antimicrobial	Limnonectes fujianensis	H-460	Lung Cancer	MTT assay	IC₅₀ = 3.47 μM	24-h	Lung	None
7602	37764521	2023	GAGIVVASIDTGVRVSHE	GE18	18	Linear	L	None	Free	Free	Antimicrobial	Aphanomyces invadans	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 35.34 µM	24-h	Breast	None
7601	36626098	2023	FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD	LFchimera	35	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic - Lectoferrin chimera	Jurkat	Blood Cancer	MTT assay	cell viability ~ 8% at 20 µM	6-h	Blood	None
7600	36626098	2023	FKCRRWQWRMKKLG-K-RSKNKGFKEQAKSLLKWILD	LFchimera	35	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic - Lectoferrin chimera	HepG-2	Liver Cancer	MTT assay	cell viability ~ 44% at 10 µM	12-h	Liver	None
7599	36626098	2023	DLIWKLLSKAQEKFGKNKSR	LFampin265–284	20	Linear	L	None	Amidation	Free	Antimicrobial	Lectoferrin Peptide	Jurkat	Blood Cancer	MTT assay	cell viability ~ 47% at 10 µM	6-h	Blood	None
7598	36626098	2023	DLIWKLLSKAQEKFGKNKSR	LFampin265–284	20	Linear	L	None	Amidation	Free	Antimicrobial	Lectoferrin Peptide	HepG-2	Liver Cancer	MTT assay	cell viability ~ 50% at 1 µM	12-h	Liver	None
7597	36626098	2023	FKCRRWQWRMKKLG	LFcin17–30	14	Linear	L	None	Amidation	Free	Antimicrobial	Lectoferrin Peptide	Jurkat	Blood Cancer	MTT assay	cell viability ~ 70% at 20 µM	6-h	Blood	None
7596	36626098	2023	FKCRRWQWRMKKLG	LFcin17–30	14	Linear	L	None	Amidation	Free	Antimicrobial	Lectoferrin Peptide	HepG-2	Liver Cancer	MTT assay	cell viability ~ 50% at 1 µM	12-h	Liver	None
7595	36626098	2023	FKCRRWQWRMKKLGAPSITCVRRAF	bLF	25	Linear	L	None	Free	Free	Antimicrobial	Bos Taurus	Jurkat	Blood Cancer	MTT assay	cell viability ~ 17.5% at 20 µM	4-h	Blood	None
7593	36509220	2023	KLLKINLK(Aib)LAALAKKIL	KM8-Aib	18	Linear	L	Aib = 2-Aminoisobutyric acid	Amidation	Free	Antimicrobial	Synthetic derivative of KM8	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
7594	36626098	2023	FKCRRWQWRMKKLGAPSITCVRRAF	bLF	25	Linear	L	None	Free	Free	Antimicrobial	Bos Taurus	HepG-2	Liver Cancer	MTT assay	cell viability ~ 21% at 10 µM	24-h	Liver	None
7592	36509220	2023	KLLKINLKALAALAKKIL	KM8	18	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic derivative of Mastoparan	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
7591	36509220	2023	INLKALAALAKKIL	Mastoparan	14	Linear	L	None	Amidation	Free	Antimicrobial	Wasp venom	Not Available	Not Available	Not Available	Not Available	Not Available	Not Available	None
7590	37380046	2023	ATRQPNH	RP7	7	Linear	L	None	Free	Free	Anticancer	RAGE(receptor for advanced glycation end product) inhibitor	BT-549	Breast Cancer	MTT assay	IC₅₀ = 29.9 µM	48-h	Breast	None
7589	37380046	2023	ATRQPNH	RP7	7	Linear	L	None	Free	Free	Anticancer	RAGE(receptor for advanced glycation end product) inhibitor	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 24.5 µM	48-h	Breast	None
7588	36567478	2023	DGDWDAWTRETS	mtp1	12	Linear	L	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	MTS assay	17.4% decrease in cell viability at 10 μM	24-h	Lung	None
7586	36567478	2023	DGDWDAWTRETS	mtp1	12	Linear	L	None	Free	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTS assay	33.6% decrease in cell viability at 10 μM	24-h	Breast	None
7587	36567478	2023	DGDWDAWTRETS	mtp1	12	Linear	L	None	Free	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTS assay	30.2 % decrease in cell viability at 10 μM	24-h	Cervix	None
7585	37273629	2023	PSRKVMLWS	PS9	9	Linear	L	None	Free	Free	Anticancer	Aphanomyces invadans	MCF-7	Breast Cancer	LDH leakage assay	71.25 ± 1.3% LDH release at 40 μM	24-h	Breast	None
7584	37273629	2023	PSRKVMLWS	PS9	9	Linear	L	None	Free	Free	Anticancer	Aphanomyces invadans	MCF-7	Breast Cancer	Neutral Red Uptake assay	IC₅₀ value range between 25.27 - 43.28 μM	24-h	Breast	None
7583	37098530	2023	GIGAVLKVLTTGLPALISWIKRKRQQ	Mellitin	26	Linear	L	None	Amidation	Free	Anticancer	Main component of honey bee venom	K-562	Leukemia Cancer	Sulforhodamine B assay	IC₅₀ = 1.84 ± 0.75 μg/ml	96-h	Blood	None
7581	37068520	2023	YSFGL	Test peptide	5	Linear	L	None	Amidation	Free	Anti cancer	Neuropep Peptide	A-549	Lung Cancer	MTT assay	IC₅₀ = 26.417±0.660 µM	48 h	Lung	None
7582	37068520	2023	YSFGL	Test peptide	5	Linear	L	None	Amidation	Free	Anti cancer	Neuropep Peptide	MDA-MB-231	Lung Cancer	MTT assay	IC₅₀ = 39.047±0.770 µM	48 h	Lung	None
7580	36830725	2023	CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK	Pep-1-Phor21	30	Linear	L	None	Free	Free	Anticancer	Hybrid peptide PEP1 and Phor 21	PC-3	Prostrate Cancer	AlamarBlue assay	IC₅₀ ≤ 0.6 μM	24-h	Prostate	None
7579	36830725	2023	CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK	Pep-1-Phor21	30	Linear	L	None	Free	Free	Anticancer	Hybrid peptide PEP1 and Phor 21	DU-145	Prostrate Cancer	AlamarBlue assay	IC₅₀ = 2.57 ± 2.02 µM	24-h	Prostate	None
7577	36168817	2023	NDGNQPL	Rapeseed peptide	7	Linear	L	None	Free	Free	Anticancer	extracted from rapeseed protein	HepG-2	Liver Cancer	Apoptosis assay	28.39 ± 0.80% apoptosis rate at 0.5 mmol/L	NA	Liver	None
7578	36830725	2023	CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK	Pep-1-Phor21	30	Linear	L	None	Free	Free	Anticancer	Hybrid peptide PEP1 and Phor 21	LNCaP	Liver Cancer	AlamarBlue assay	IC₅₀ = 55.13 ± 13.56 µM	24-h	Liver	None
7576	36168817	2023	NDGNQPL	Rapeseed peptide	7	Linear	L	None	Free	Free	Anticancer	extracted from rapeseed protein	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 1.56 mmol/L	24-h	Liver	None
7575	37514049	2023	FAVWGCADYRGY	Salamandrin - I	12	Linear	L	None	Amidation	Free	Antioxidant	Salamandra salamandra	HL-60	Leukemia Cancer	LDH leakage assay	Absorbance ~ 2 at 490 nm at 27 27 µM	48-h	Blood	None
7574	37514049	2023	FAVWGCADYRGY	Salamandrin - I	12	Linear	L	None	Amidation	Free	Antioxidant	Salamandra salamandra	HL-60	Leukemia Cancer	MTT assay	IC₅₀ = 27 µM	48-h	Blood	None
7573	37580909	2023	QETFSDLWKLLVQRKRQKLMP	mPNC-NLS	21	Linear	L	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	Cytotoxicity assay	IC₅₀ = 45 μM	24-h	Lung	None
7572	37580909	2023	QETFSDLWKLLVQRKRQKLMP	mPNC-NLS	21	Linear	L	None	Free	Free	Anticancer	Synthetic	U-87	Brain Tumor	MTT assay	IC₅₀ = 56.9 μM	24-h	Brain	None
7571	37580909	2023	QETFSDLWKLLVQRKRQKLMP	mPNC-NLS	21	Linear	L	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 44.9 μM	24-h	Lung	None
7570	36730301	2023	VNWKKILGKIIKVVK	Lasioglossin - III	15	Linear	L	None	Amidation	Free	Antimicrobial	Lasioglossum laticeps	HepG-2	Liver Cancer	Not Available	IC₅₀ = 7.75 μM	Not Available	Liver	None
7569	36730301	2023	VNWKKILGKIIKVVK	Lasioglossin - III	15	Linear	L	None	Amidation	Free	Antimicrobial	Lasioglossum laticeps	A-549	Lung Cancer	Not Available	IC₅₀ = 26.36 μM	Not Available	Lung	None
7568	37483971	2023	THPPTTTTTTTTTTTYTAAPATTT	ATMP1	24	Linear	L	None	Free	Free	Antimicrobial	Anabas testudineus	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 8.25 ± 0.14 μg/ml	48-h	Breast	None
7567	37483971	2023	THPPTTTTTTTTTTTYTAAPATTT	ATMP5	24	Linear	L	None	Free	Free	Anticancer; Antimicrobial	Synthetic Analog of ATMP1	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 64.04 ± 0.021 μg /ml	24-h	Breast	None
7566	None	2023	AWLDKLKSIGKVVGKVAIGVAKNLLNPQ	Raniseptin-3	28	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Boana raniceps	B16-F10	Skin Cancer	MTT assay	IC₅₀ = 6.56 uM	3-h	Skin	None
7564	36910465	2023	KLWCKSSQVPQSR	ALA-A2	13	Linear	L	None	Free	Free	Anticancer	Alpha-Lactalbumin	HT-29	Colon Cancer	MTT assay	~50% cell viability	24-h	Colon	None
7565	None	2023	ALLDKLKSLGKVVGKVALGVVQNYLNPRQ	Raniseptin-6	29	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Boana raniceps	B16-F10	Skin Cancer	MTT assay	IC₅₀ = 8.69 uM	3-h	Skin	None
7563	36910465	2023	KLWCKSSQVPQSR	ALA-A2	13	Linear	L	None	Free	Free	Anticancer	Alpha-Lactalbumin	A-549	Lung Cancer	MTT assay	~50% cell viability	24-h	Lung	None
7562	37310533	2023	RIIDRLWLVRRPQKPKFVLVWVL	PMAP-NC	23	Linear	L	None	Free	Free	Antimicrobial	Synthetic Analgog of PMAP-24	A-549	Lung Cancer	MTT assay	IC₅₀ = 7.1 μM	4-h	Lung	None
7561	37310533	2023	RIIDRLWLVRRPQKPKFVLVWVL	PMAP-NC	23	Linear	L	None	Free	Free	Antimicrobial	Synthetic Analgog of PMAP-23	MDA-MB-361	Breast Cancer	MTT assay	IC₅₀ = 6.4 μM	4-h	Breast	None
7560	37183466	2023	WKLFKKILKVL	CM11	11	Linear	L	None	Amidation	Free	Antimicrobial	Cecropin-Melittin Hybrid Peptide	Raji	Blood Cancer	MTT assay	Survival rate = 51% at 32 μg/ml	24-h	Blood	None
7559	37183466	2023	WKLFKKILKVL	CM11	11	Linear	L	None	Amidation	Free	Antimicrobial	Cecropin-Melittin Hybrid Peptide	Jurkat	Blood Cancer	MTT assay	Survival rate = 47% at 32 μg/ml	24-h	Blood	None
7558	37764334	2023	ALWKSILKNAGKAVLNEINQIV	14VL23	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-460	Lung Cancer	MTT assay	IC₅₀ = 16.4 µM	24-h	Lung	None
7557	37764334	2023	ALWKSILKNAGKAVLNEINQIV	14VL23	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-838	Lung Cancer	MTT assay	IC₅₀ = 5.7 µM	24-h	Lung	None
7556	37764334	2023	ALWKKILKNAGKAVLNEINQIVQ	14V5K	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-460	Lung Cancer	MTT assay	IC₅₀ = 6.1 µM	24-h	Lung	None
7555	37764334	2023	ALWKKILKNAGKAVLNEINQIVQ	14V5K	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-838	Lung Cancer	MTT assay	IC₅₀ = 8.1 µM	24-h	Lung	None
7554	37764334	2023	ALWKSILKNVGKVLNEINQIVQ	L2V	22	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-460	Lung Cancer	MTT assay	IC₅₀ = 0.6 µM	24-h	Lung	None
7553	37764334	2023	ALWKSILKNVGKVLNEINQIVQ	L2V	22	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-838	Lung Cancer	MTT assay	IC₅₀ = 2.2 µM	24-h	Lung	None
7552	37764334	2023	ALWKSILKNAGKAGLNEINQIVQ	14G	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-460	Lung Cancer	MTT assay	IC₅₀ = 31.7 µM	24-h	Lung	None
7551	37764334	2023	ALWKSILKNAGKAGLNEINQIVQ	14G	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-838	Lung Cancer	MTT assay	IC₅₀ = 48.7 µM	24-h	Lung	None
7550	37764334	2023	ALWKSILKNAGKAVLNEINQIVQ	14V	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-460	Lung Cancer	MTT assay	IC₅₀ = 4.1 µM	24-h	Lung	None
7549	37764334	2023	ALWKSILKNAGKAVLNEINQIVQ	14V	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-838	Lung Cancer	MTT assay	IC₅₀ = 7.0 µM	24-h	Lung	None
7548	37764334	2023	ALWKSILKNAGKALNEINQIVQ	L14	22	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-460	Lung Cancer	MTT assay	IC₅₀ = 20.1 µM	24-h	Lung	None
7547	37764334	2023	ALWKSILKNAGKALNEINQIVQ	L14	22	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Dermaseptin-SS1- Analog	H-838	Lung Cancer	MTT assay	IC₅₀ = 64.4 µM	24-h	Lung	None
7546	37764334	2023	ALWKSILKNAGKAALNEINQIV	Dermaseptin-SS1	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Brown-belly leaf frog, Phyllomedusa Tarsius	H-460	Lung Cancer	MTT assay	IC₅₀ = 1.3 µM	24-h	Lung	None
7544	36982610	2023	UKLUGGLUGI	K2-NH₂	10	Linear	L	U = 2-Aminoisobutyric acid	Amidation	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ = 9 µM	24-h	Breast	None
7545	37764334	2023	ALWKSILKNAGKAALNEINQIV	Dermaseptin-SS1	23	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Brown-belly leaf frog, Phyllomedusa Tarsius	H-838	Lung Cancer	MTT assay	IC₅₀ = 7.7 µM	24-h	Lung	None
7542	36982610	2023	UGLUKKLUGI	K56-Lol	10	Linear	L	U = 2-Aminoisobutyric acid	Lol = leucinol	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ =12 µM	24-h	Breast	None
7543	36982610	2023	UGLUGKLUGI	K6-NH₂	10	Linear	L	U = 2-Aminoisobutyric acid	Amidation	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ =8 µM	24-h	Breast	None
7540	36982610	2023	UKLUKGLUKI	K259-Lol	10	Linear	L	U = 2-Aminoisobutyric acid	Lol = leucinol	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ =10 µM	24-h	Breast	None
7541	36982610	2023	UKLUKGLUGI	K25-Lol	10	Linear	L	U = 2-Aminoisobutyric acid	Lol = leucinol	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ =9 µM	24-h	Breast	None
7539	36982610	2023	UKLUKGLUKI	K259-NH₂	10	Linear	L	U = 2-Aminoisobutyric acid	Amidation	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ =13 µM	24-h	Breast	None
7537	36982610	2023	UGLLGGLUGI	Leu4-NH₂	10	Linear	L	U = 2-Aminoisobutyric acid	Amidation	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ > 20 µM	24-h	Breast	None
7538	36982610	2023	UKLUKKLUKI	K2569-Lol	10	Linear	L	U = 2-Aminoisobutyric acid	Lol = leucinol	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ = 12 µM	24-h	Breast	None
7536	36982610	2023	UGLUGGLZGI	Api8-NH₂	10	Linear	L	Z =4-aminopiperidine-4-carboxylic acid , U = 2-Aminoisobutyric acid	Amidation	Oct = 1-octanoyl	Antimicrobial and Antifungal	Trichogin GA	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ > 20 µM	24-h	Breast	None
7534	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 18	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	decanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.2 μM	24-h	Pancreas	None
7535	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 19	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	dodecanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.2 μM	24-h	Pancreas	None
7533	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 17	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Octanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.6 μM	24-h	Pancreas	None
7532	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 16	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Hexanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.5 μM	24-h	Pancreas	None
7530	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 14	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Propanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 1.8 μM	24-h	Pancreas	None
7531	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 15	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Butanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.9 μM	24-h	Pancreas	None
7529	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 13	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Ethanoyl	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 6.0 μM	24-h	Pancreas	None
7528	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 12	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Free	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ > 9 μM	24-h	Pancreas	None
7527	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 4	10	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Free	Antitubercular	Trichoderin A	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.5 μM	24-h	Pancreas	None
7525	36678914	2023	MDA-P-AHMOD-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 19	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	dodecanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.1 μM	24-h	Pancreas	None
7526	36678914	2023	MDA-P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A	10	Linear	L	MDA = 2-methyl decanoic acid; AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Free	Antitubercular	Trichoderma sp. fungus, strain 05FI48	PANC-1	Pancreatic Cancer	CyQUANT Direct assay	IC₅₀ = 0.3 μM	24-h	Pancreas	None
7524	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 18	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	decanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.2 μM	24-h	Pancreas	None
7523	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 17	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid; AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Octanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.4 μM	24-h	Pancreas	None
7522	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 16	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Hexanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.4 μM	24-h	Pancreas	None
7521	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 15	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Butanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.5 μM	24-h	Pancreas	None
7519	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 13	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Ethanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ > 1 μM	24-h	Pancreas	None
7520	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 14	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Propanoyl	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.6 μM	24-h	Pancreas	None
7518	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 12	9	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Free	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ > 1 μM	24-h	Pancreas	None
7516	36678914	2023	MDA-P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A	10	Linear	L	MDA = 2-methyl decanoic acid; AHMOD = 2-amino-6-hydroxy-4-methyl-8-oxodecanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Free	Antitubercular	Trichoderma sp. fungus, strain 05FI48	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.4 μM	24-h	Pancreas	None
7517	36678914	2023	P-Cha-Aib-Aib-IV-Aib-Aib-AMAE	trichoderin A analogue 4	10	Linear	L	AHMOD replaced by Cha(L-cyclohexylalanine); MDA = 2-methyl decanoic acid; Aib = a-aminoisobutyric acid;AMAE = 2-[(20-aminopropyl) methylamino] ethanol	Free	Free	Antitubercular	Trichoderin A	BxPC-3	Pancreatic Cancer	PrestoBlue assay	IC₅₀ = 0.4 μM	24-h	Pancreas	None
7515	37228702	2023	FLPLLAGLAANFLPKIICKIARKC	B1AW-K	24	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	analogue of B1AW	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 3.860 µM	24-h	Brain	None
7514	37228702	2023	FLPLLAGLAANFLPKIICKIARKC	B1AW-K	24	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	analogue of B1AW	H-838	Lung Cancer	MTT assay	IC₅₀ = 5.15 µM	24-h	Lung	None
7513	37228702	2023	FLPLLAGLAANFLPKIICKIARKC	B1AW-K	24	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	analogue of B1AW	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 4.283 µM	24-h	Prostate	None
7512	37228702	2023	FLPLLAGLAANFLPQIICKIARKC	B1AW	24	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Wuyi torrent frog, Amolops wuyiensis	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 33.56 µM	24-h	Brain	None
7511	37228702	2023	FLPLLAGLAANFLPQIICKIARKC	B1AW	24	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Wuyi torrent frog, Amolops wuyiensis	H-838	Lung Cancer	MTT assay	IC₅₀ = 32.15 µM	24-h	Lung	None
7510	37228702	2023	FLPLLAGLAANFLPQIICKIARKC	B1AW	24	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Wuyi torrent frog, Amolops wuyiensis	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 33.46 µM	24-h	Prostate	None
7509	37508198	2023	FLGVALKLGKVLGKALLPLASSLLHSQ	Figanin 2BN	27	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	HT-29	Colon Cancer	MTT assay	LC₅₀ = 14.1 uM	24-h	Colon	None
7508	37508198	2023	FLGVALKLGKVLGKALLPLASSLLHSQ	Figanin 2BN	27	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	MDA-MB-231	Breast Cancer	MTT assay	LC₅₀ = 8.1 uM	24-h	Breast	None
7507	37508198	2023	FLGVALKLGKVLGKALLPLASSLLHSQ	Figanin 2BN	27	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	A-549	Lung Cancer	MTT assay	LC₅₀ = 6.7 uM	24-h	Lung	None
7506	37508198	2023	GIFKDTLKKVVAAVLTTVADNIHPK	Picturin 1BN	25	Linaer	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	HT-29	Colon Cancer	MTT assay	LC₅₀ = 84.9 uM	24-h	Colon	None
7505	37508198	2023	GIFKDTLKKVVAAVLTTVADNIHPK	Picturin 1BN	25	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	MDA-MB-231	Breast Cancer	MTT assay	LC₅₀ = 64.2 uM	24-h	Breast	None
7504	37508198	2023	GIFKDTLKKVVAAVLTTVADNIHPK	Picturin 1BN	25	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	A-549	Lung Cancer	MTT assay	LC₅₀ = 30.7 µM	24-h	Lung	None
7503	37508198	2023	GLMDMLKKVGKVALTVAKSALLP	Picturin 2BN	23	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	HT-29	Colon Cancer	MTT assay	LC₅₀ 52.2 uM	24-h	Colon	None
7502	37508198	2023	GLMDMLKKVGKVALTVAKSALLP	Picturin 2BN	23	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	MDA-MB-231	Breast Cancer	MTT assay	LC₅₀ 26.3 uM	24-h	Breast	None
7501	37508198	2023	GLMDMLKKVGKVALTVAKSALLP	Picturin 2BN	23	Linear	L	None	Amidation	Free	Antimicrobial and Antitumor	Giant Gladiator Treefrog (Boana boans)	A-549	Lung Cancer	MTT assay	LC₅₀ = 23 µM	24-h	Lung	None
7500	37598210	2023	grrrqrrkkrlgpfsidllikslsdnmtdl	M1-20	30	Linear	D	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 32.47 µM	36-h	Lung	None
7499	37598210	2023	grrrqrrkkrlgpfsidllikslsdnmtdl	M1-20	30	Linear	D	None	Free	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	CCK-8 assay	IC₅₀ = 25.65 µM	36-h	Bone	None
7498	37598210	2023	grrrqrrkkrlgpfsidllikslsdnmtdl	M1-20	30	Linear	D	None	Free	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	CCK-8 assay	IC₅₀ = 42.95 µM	36-h	Cervix	None
7497	37598210	2023	grrrqrrkkrlgpfsidllikslsdnmtdl	M1-20	30	Linear	D	None	Free	Free	Anticancer	Synthetic	ZR-75-30	Breast Cancer	CCK-8 assay	IC₅₀ = 23.57 µM	36-h	Breast	None
7496	37598210	2023	grrrqrrkkrlgpfsidllikslsdnmtdl	M1-20	30	Linear	D	None	Free	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	CCK-8 assay	IC₅₀ = 31.05 µM	36-h	Breast	None
7495	37598210	2023	grrrqrrkkrlgpfsidllikslsdnmtdl	M1-20	30	Linear	D	None	Free	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	CCK-8 assay	IC₅₀ = 18.15 µM	36-h	Breast	None
7494	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	ZR-75-30	Breast Cancer	Cell Viability assay	IC₅₀ = 12.92 µM	72-h	Breast	None
7493	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	U-251	BrainTumor	Cell Viability assay	IC₅₀ = 18.17 µM	72-h	Brain	None
7492	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	Cell Viability assay	IC₅₀ = 22.00 µM	72-h	Lung	None
7491	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	HCT-116	Colon Cancer	Cell Viability assay	IC₅₀ = 9.08 µM	72-h	Colon	None
7490	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	786-0	Renal Cancer	Cell Viability assay	IC₅₀ = 13.5 µM	72-h	Renal	None
7489	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	Cell Viability assay	IC₅₀ = 31.83 µM	72-h	Cervix	None
7488	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	5637	Bladder cancer	Cell Viability assay	IC₅₀ = 9.33 µM	72-h	Bladder	None
7487	37344857	2023	rrrqrrkkrg-QTQPRLGPPQTPAGGCSILIF	M1-21	31	Linear	Mix	None	Free	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	Cell Viability assay	IC₅₀ = 24.25 µM	72-h	Breast	None
7480	37396945	2023	LSTAADMQGVVTDGMASGLDKDYLKPDD	p28	28	Linear	L	None	Free	Free	Antitumor	Pseudomonas aeruginosa	CT-26	Colorectal Cancer	MTT assay	IC₅₀ ~ 150 μg/ml	24-h	Colon	None
7479	37396945	2023	LSTAADMQGVVTDGMASGLDKDYLKPDD	p28	28	Linear	L	None	Free	Free	Antitumor	Pseudomonas aeruginosa	HT-29	Colon Cancer	MTT assay	IC₅₀ ~ 200 μg/ml	24-h	Colon	None
7477	36687035	2023	WQWRWQWR	1-R	8	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 130 µM	24-h	Breast	None
7478	36687035	2023	WQWRWQWR	1-R	8	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ > 150 µM	24-h	Breast	None
7476	36687035	2023	RWQWRWQW	R-1	8	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ > 150 µM	24-h	Breast	None
7475	36687035	2023	RWQWRWQW	R-1	8	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 58 µM	24-h	Breast	None
7473	36687035	2023	WQWRWQW	1	7	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 105 µM	24-h	Breast	None
7474	36687035	2023	WQWRWQW	1	7	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ > 170 µM	24-h	Breast	None
7471	36687035	2023	RRWQWRWQWR	RR-1-R	10	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 68 µM	24-h	Breast	None
7472	36687035	2023	RRWQWRWQWR	RR-1-R	10	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 73 µM	24-h	Breast	None
7470	36687035	2023	RWQWRWQWRR	R-1-RR	10	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 95 µM	24-h	Breast	None
7468	36687035	2023	RRWQWRWQWRR	RR-1-RR	11	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 67 µM	24-h	Breast	None
7469	36687035	2023	RWQWRWQWRR	R-1-RR	10	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 122 µM	24-h	Breast	None
7466	36687035	2023	RWQWRWQWR	LfcinB(21-25)Pal	9	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	LfcinB	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 81 µM	24-h	Breast	None
7467	36687035	2023	RRWQWRWQWRR	RR-1-RR	11	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	Synthetic analogue of LfcinB(21-25)Pal	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 58 µM	24-h	Breast	None
7465	36687035	2023	RWQWRWQWR	LfcinB(21-25)Pal	9	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	LfcinB	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 103 µM	24-h	Breast	None
7463	37818062	2023	FAAATGATPIAGR	P10	13	Linear	L	None	Free	Free	Anticancer	40S ribosomal protein fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 1.01 at 50 μg/ml	48-h	Bone	None
7464	36687035	2023	RWQWRWQWR	LfcinB(21-25)Pal	9	Linear	L	None	Amidation	Free	Antibacterial and Anticancer	LfcinB	MDA-MB-468	Breast Cancer	MTT assay	IC₅₀ = 72 µM	24-h	Breast	None
7461	37818062	2023	AAGTLYTYPENWR	P09	13	Linear	L	None	Free	Free	Anticancer	Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 1.07 at 50 μg/ml	48-h	Bone	None
7462	37818062	2023	FAAATGATPIAGR	P10	13	Linear	L	None	Free	Free	Anticancer	40S ribosomal protein fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 1.08 at 50 μg/ml	48-h	Bone	None
7460	37818062	2023	AAGTLYTYPENWR	P09	13	Linear	L	None	Free	Free	Anticancer	Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.85 at 50 μg/ml	48-h	Bone	None
7458	37818062	2023	NSNLVGAAHEELQQSR	P08	16	Linear	L	None	Free	Free	Anticancer	Lamin A/C (LMNA) fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.92 at 50 μg/ml	48-h	Bone	None
7459	37818062	2023	NSNLVGAAHEELQQSR	P08	16	Linear	L	None	Free	Free	Anticancer	Lamin A/C (LMNA) fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 1.06 at 50 μg/ml	48-h	Bone	None
7456	37818062	2023	VEPGLGADNSVVR	P07	13	Linear	L	None	Free	Free	Anticancer	FLNA (Filamin A) fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.96 at 50 μg/ml	48-h	Bone	None
7457	37818062	2023	VEPGLGADNSVVR	P07	13	Linear	L	None	Free	Free	Anticancer	FLNA (Filamin A) fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 0.96 at 50 μg/ml	48-h	Bone	None
7454	37818062	2023	GAGTGGLGLAVEGPSEAK	P06	18	Linear	L	None	Free	Free	Anticancer	FLNA (Filamin A) fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.92 at 50 μg/ml	48-h	Bone	None
7455	37818062	2023	GAGTGGLGLAVEGPSEAK	P06	18	Linear	L	None	Free	Free	Anticancer	FLNA (Filamin A) fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 1.17 at 50 μg/ml	48-h	Bone	None
7453	37818062	2023	HVFGESDELIGQK	P03	13	Linear	L	None	Free	Free	Anticancer	Triosephosphate Isomerase (TPI) fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 0.98 at 50 μg/ml	48-h	Bone	None
7451	37818062	2023	SETAPAAPAAPAPAEK	P01	16	Linear	L	None	Free	Free	Anticancer	Histone H1.4 (H1-4) Fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 1.13 at 50 μg/ml	48-h	Bone	None
7452	37818062	2023	HVFGESDELIGQK	P03	13	Linear	L	None	Free	Free	Anticancer	Triosephosphate Isomerase (TPI) fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 1.04 at 50 μg/ml	48-h	Bone	None
7449	37818062	2023	IGEHTPSALAIMENANVLAR	P04	20	Linear	L	None	Free	Free	Anticancer	Aldolase A fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 0.83 at 50 μg/ml	48-h	Bone	None
7450	37818062	2023	SETAPAAPAAPAPAEK	P01	16	Linear	L	None	Free	Free	Anticancer	Histone H1.4 (H1-4) Fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.84 at 50 μg/ml	48-h	Bone	None
7448	37818062	2023	IGEHTPSALAIMENANVLAR	P04	20	Linear	L	None	Free	Free	Anticancer	Aldolase A fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.86 at 50 μg/ml	48-h	Bone	None
7446	37818062	2023	AEEYEFLTPMEEAPK	P02	15	Linear	L	None	Free	Free	Anticancer	Rho GDP Dissociation Inhibitor Alpha fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.88 at 50 μg/ml	48-h	Bone	None
7447	37818062	2023	AEEYEFLTPMEEAPK	P02	15	Linear	L	None	Free	Free	Anticancer	Rho GDP Dissociation Inhibitor Alpha fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 0.93 at 50 μg/ml	48-h	Bone	None
7445	37818062	2023	ADDGRPFPQVIK	P05	12	Linear	L	None	Free	Free	Anticancer	Aldolase A fragment	U-2 OS	Bone Cancer	MTT assay	Relative viability = 0.98 at 50 μg/ml	48-h	Bone	None
7444	37818062	2023	ADDGRPFPQVIK	P05	12	Linear	L	None	Free	Free	Anticancer	Aldolase A fragment	MG-63	Bone Cancer	MTT assay	Relative viability = 0.85 at 50 μg/ml	48-h	Bone	None
7443	37495988	2023	TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC	37-mer peptide	37	Linear	L	None	Free	Free	Antimicrobial	Synthetic	SK-OV-3	Ovarian cancer	MTT assay	IC₅₀ = 27.45 ± 1.5085 μM	24-h	Ovary	None
7442	37495988	2023	TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC	37-mer peptide	37	Linear	L	None	Free	Free	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 33.65 ± 1.09 μM	24-h	Liver	None
7441	37495988	2023	TKEQKEQIAKATGLTTKQVRNWYVQLNASIKVCMCSC	37-mer peptide	37	Linear	L	None	Free	Free	Antimicrobial	Synthetic	SNU-449	Liver Cancer	MTT assay	IC₅₀ = 76.4 ± 0.6015 μM	24-h	Liver	None
7440	37646048	2023	RRRRRGLFDIIKKIIKSF	Aurein 1.2_mutant_R5 (R5-Aurm)	18	Linear	L	None	Free	Acetylation	Antimicrobial	Synthetic	HT-29	Colon Cancer	MTT assay	54.22% cell viability	24-h	Colon	None
7439	37646048	2023	RRRRRGLFDIIKKIIKSF	Aurein 1.2_mutant_R5 (R5-Aurm)	18	Linear	L	None	Free	Acetylation	Antimicrobial	Synthetic	SW-480	Colon Cancer	MTT assay	40.62% cell viability	24-h	Colon	None
7438	37646048	2023	RRRRRGLFDIIKKIAESF	Aurein 1.2_R5 (R5-Aur)	18	Linear	L	None	Free	Acetylation	Antimicrobial	Synthetic	HT-29	Colon Cancer	MTT assay	61.56% cell viability	24-h	Colon	None
7436	37646048	2023	GLFDIIKKIIKSF	Aurein 1.2_mutant (Aurm)	13	Linear	L	None	Free	Acetylation	Antimicrobial	Synthetic	HT-29	Colon Cancer	MTT assay	66.10% cell viability	24-h	Colon	None
7437	37646048	2023	RRRRRGLFDIIKKIAESF	Aurein 1.2_R5 (R5-Aur)	18	Linear	L	None	Free	Acetylation	Antimicrobial	Synthetic	SW-480	Colon Cancer	MTT assay	43.89% cell viability	24-h	Colon	None
7435	37646048	2023	GLFDIIKKIIKSF	Aurein 1.2_mutant (Aurm)	13	Linear	L	None	Free	Acetylation	Antimicrobial	Synthetic	SW-480	Colon Cancer	MTT assay	51.63% cell viability	24-h	Colon	None
7434	37867694	2023	rWQWOWQWR	1[^dR] 5[Orn] [Pal]	9	Linear	Mix	O=Ornithine	Amidation	Free	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 109 μM	24-h	Colon	None
7433	37867694	2023	RWQWOWQWR	5[Orn] [Pal]	9	Linear	L	O=Ornithine	Amidation	Free	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 64 μM	24-h	Colon	None
7432	37867694	2023	OWQWRWQWR	1[Orn] [Pal]	9	Linear	L	O=Ornithine	Amidation	Free	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 91 μM	24-h	Colon	None
7430	37867694	2023	CH₃-CO-Ahx-RWQWRWQWR	CH₃CO-Ahx-[Pal]	10	Linear	L	Ahx = Amino Hexanoic Acid	Amidation	Acetylation	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 31 μM	24-h	Colon	None
7431	37867694	2023	rWQWRWQWR	1[^dR][Pal]	9	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 105 μM	24-h	Colon	None
7429	37867694	2023	RWQWRWQWO	9[Orn] [Pal]	9	Linear	L	O=Ornithine	Amidation	Free	Anticancer	Synthetic	DU-145	Prostrate Cancer	MTT assay	IC₅₀ = 62 μM	24-h	Prostate	None
7427	37867694	2023	RWQWRWQWO	9[Orn] [Pal]	9	Linear	L	O=Ornithine	Amidation	Free	Anticancer	Synthetic	HT-29	Colon Cancer	MTT assay	IC₅₀ = 109 μM	24-h	Colon	None
7428	37867694	2023	RWQWRWQWO	9[Orn] [Pal]	9	Linear	L	O=Ornithine	Amidation	Free	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 40 μM	24-h	Colon	None
7425	37867694	2023	Ahx-RWQWRWQWR	Ahx-[Pal]	10	Linear	L	Ahx = Amino Hexanoic Acid	Amidation	Free	Anticancer	Synthetic	HT-29	Colon Cancer	MTT assay	IC₅₀ = 119 μM	24-h	Colon	None
7426	37867694	2023	Ahx-RWQWRWQWR	Ahx-[Pal]	10	Linear	L	Ahx = Amino Hexanoic Acid	Amidation	Free	Anticancer	Synthetic	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 40 μM	24-h	Colon	None
7424	37867694	2023	RWQWRWQWR	LfcinB (21-25)Pal	9	Linear	L	None	Amidation	Free	Anticancer	LfcinB	DU-145	Prostrate Cancer	MTT assay	IC₅₀ = 40 μM	24-h	Prostate	None
7423	37867694	2023	RWQWRWQWR	LfcinB (21-25)Pal	9	Linear	L	None	Amidation	Free	Anticancer	LfcinB	HT-29	Colon Cancer	MTT assay	IC₅₀ = 100 μM	24-h	Colon	None
7422	37867694	2023	RWQWRWQWR	LfcinB (21-25)Pal	9	Linear	L	None	Amidation	Free	Anticancer	LfcinB	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 86 μM	24-h	Colon	None
7421	36410436	2023	RRRRNRTRRNRRRVRGGLTIYFY	FHV-2D5	23	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-G	48-h	Liver	None
7420	36410436	2023	TRRQRTRRARRNRGGLTIYFY	HTLV-II-Rex-2D5	21	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-G	48-h	Liver	None
7419	36410436	2023	GRKKRRQRRRPPQGGLTIYFY	TAT-2D5	21	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-G	48-h	Liver	None
7418	36410436	2023	RRRRRRRRGGILTVVELRVP	6F (I113-P122)	20	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-D	48-h	Liver	None
7417	36410436	2023	RRRRRRRRGGVVELRVPTDLTLLPGHLYMM	6E(V116-M135)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-D	48-h	Liver	None
7416	36410436	2023	RRRRRRRRGGGLTIYFY	2D5(G45-Y51)	17	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	IC₅₀ = 19.4 μM	48-h	Liver	None
7415	36410436	2023	RRRRRRRRGGGLTIYFYN	2D3(G45-N52)	18	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-C	48-h	Liver	None
7414	36410436	2023	RRRRRRRRGGQGLTIYFY	2D2(Q44-Y51)	18	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-C	48-h	Liver	None
7413	36410436	2023	RRRRRRRRGGQGLTIYFYNSNR	2D(Q44-R55)	22	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-C	48-h	Liver	None
7412	36410436	2023	RRRRRRRRGGQGLTIYFYNSNRDFQ	2C(Q44-Q58)	25	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-C	48-h	Liver	None
7411	36410436	2023	RRRRRRRRGGFWAGLQGLTIYFYNSNRDFQ	2A(F39-Q58)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-C	48-h	Liver	None
7410	36410436	2023	RRRRRRRRGGMWKGFILTVVELRVPTDLTL	#6(M108-L127)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	MCF-7	Breast Cancer	CellTiter-Glo assay	Graph figure 1-B	48-h	Breast	None
7409	36410436	2023	RRRRRRRRGGMWKGFILTVVELRVPTDLTL	#6(M108-L127)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-B	48-h	Liver	None
7408	36410436	2023	RRRRRRRRGGDQEIKFKVETLECREMWKGF	#5(D93-F112)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-B	48-h	Liver	None
7407	36410436	2023	RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN	#2(D33-N52)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	MCF-7	Breast Cancer	CellTiter-Glo assay	Graph figure 1-B	48-h	Breast	None
7406	36410436	2023	RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN	#2(D33-N52)	30	Linear	L	None	Free	Free	Anticancer	STAP-2 PH domain–derived peptide	DU-145	Liver Cancer	CellTiter-Glo assay	Graph figure 1-B	48-h	Liver	None
7405	37833918	2023	RLRRILRKIVRRL	Crabrolin-PR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 12.29 μM	24-h	Breast	None
7404	37833918	2023	RLRRILRKIVRRL	Crabrolin-PR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 16.29 μM	24-h	Colon	None
7403	37833918	2023	RLRRILRKIVRRL	Crabrolin-PR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 17.70 μM	24-h	Brain	None
7402	37833918	2023	RLRRILRKIVRRL	Crabrolin-PR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 22.37 μM	24-h	Prostate	None
7401	37833918	2023	RLRRILRKIVRRL	Crabrolin-PR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	H-838	Lung Cancer	MTT assay	IC₅₀ = 32.32 μM	24-h	Lung	None
7399	37833918	2023	RLPRILRKIVRRL	Crabrolin-AR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 29.90 μM	24-h	Colon	None
7400	37833918	2023	RLPRILRKIVRRL	Crabrolin-AR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 32.51 μM	24-h	Breast	None
7398	37833918	2023	RLPRILRKIVRRL	Crabrolin-AR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 52.01 μM	24-h	Brain	None
7397	37833918	2023	RLPRILRKIVRRL	Crabrolin-AR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 28.78 μM	24-h	Prostate	None
7396	37833918	2023	RLPRILRKIVRRL	Crabrolin-AR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	H-838	Lung Cancer	MTT assay	IC₅₀ = 41.31 μM	24-h	Lung	None
7395	37833918	2023	RLPRILRKIVRAL	Crabrolin-FR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 33.85 μM	24-h	Breast	None
7394	37833918	2023	RLPRILRKIVRAL	Crabrolin-FR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 30.29 μM	24-h	Colon	None
7392	37833918	2023	RLPRILRKIVRAL	Crabrolin-FR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 15.87 μM	24-h	Prostate	None
7393	37833918	2023	RLPRILRKIVRAL	Crabrolin-FR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 62.17 μM	24-h	Brain	None
7391	37833918	2023	RLPRILRKIVRAL	Crabrolin-FR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	H-838	Lung Cancer	MTT assay	IC₅₀ = 31.51 μM	24-h	Lung	None
7390	37833918	2023	FLPRILRKIVRAL	Crabrolin-TR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 3.459 μM	24-h	Breast	None
7389	37833918	2023	FLPRILRKIVRAL	Crabrolin-TR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 2.810 μM	24-h	Colon	None
7388	37833918	2023	FLPRILRKIVRAL	Crabrolin-TR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 12.40 μM	24-h	Brain	None
7387	37833918	2023	FLPRILRKIVRAL	Crabrolin-TR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 3.944 μM	24-h	Prostate	None
7385	37833918	2023	FLPKILRKIVTAL	Crabrolin-4K	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 23.18 μM	24-h	Breast	None
7386	37833918	2023	FLPRILRKIVRAL	Crabrolin-TR	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	H-838	Lung Cancer	MTT assay	IC₅₀ = 4.637 μM	24-h	Lung	None
7384	37833918	2023	FLPKILRKIVTAL	Crabrolin-4K	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 42.88 μM	24-h	Colon	None
7383	37833918	2023	FLPKILRKIVTAL	Crabrolin-4K	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 23.51 μM	24-h	Brain	None
7382	37833918	2023	FLPKILRKIVTAL	Crabrolin-4K	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 20.58 μM	24-h	Prostate	None
7380	37833918	2023	FLPRILRKIVTAL	Crabrolin-4R	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 20.26 μM	24-h	Breast	None
7381	37833918	2023	FLPKILRKIVTAL	Crabrolin-4K	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	H-838	Lung Cancer	MTT assay	IC₅₀ = 22.55 μM	24-h	Lung	None
7379	37833918	2023	FLPRILRKIVTAL	Crabrolin-4R	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 47.02 μM	24-h	Colon	None
7378	37833918	2023	FLPRILRKIVTAL	Crabrolin-4R	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 25.09 μM	24-h	Brain	None
7377	37833918	2023	FLPRILRKIVTAL	Crabrolin-4R	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 17.98 μM	24-h	Prostate	None
7375	37833918	2023	FLPLILRKIVTAL	Crabrolin	13	Linear	L	None	Amidation	Free	Antimicrobial	European hornet (Vespa crabro)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 26.49 μM	24-h	Breast	None
7376	37833918	2023	FLPRILRKIVTAL	Crabrolin-4R	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic Analog of Crabrolin	H-838	Lung Cancer	MTT assay	IC₅₀ = 11.40 μM	24-h	Lung	None
7374	37833918	2023	FLPLILRKIVTAL	Crabrolin	13	Linear	L	None	Amidation	Free	Antimicrobial	European hornet (Vespa crabro)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 8.539 μM	24-h	Colon	None
7373	37833918	2023	FLPLILRKIVTAL	Crabrolin	13	Linear	L	None	Amidation	Free	Antimicrobial	European hornet (Vespa crabro)	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 20.13 μM	24-h	Brain	None
7371	37833918	2023	FLPLILRKIVTAL	Crabrolin	13	Linear	L	None	Amidation	Free	Antimicrobial	European hornet (Vespa crabro)	H-838	Lung Cancer	MTT assay	IC₅₀ = 27.71 μM	24-h	Lung	None
7372	37833918	2023	FLPLILRKIVTAL	Crabrolin	13	Linear	L	None	Amidation	Free	Antimicrobial	European hornet (Vespa crabro)	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 32.13 μM	24-h	Prostate	None
7368	35889301	2022	LXVLF	Sansalvimide A	5	Cyclic	L	X = OLeu	Cyclized	Cyclized	Anticancer	Fusarium sp.	HCT-116	Colon Cancer	Not Available	IC₅₀ = 9.8 µg/ml	Not Available	Colon	None
7369	35889301	2022	LXVLF	Sansalvimide A	5	Cyclic	L	X = OLeu	Cyclized	Cyclized	Anticancer	Fusarium sp.	Colo-205	Colon Cancer	Not Available	IC₅₀ = 3.5 µg/ml	Not Available	Colon	None
7370	35889301	2022	LXVLF	Sansalvimide A	5	Cyclic	L	X = OLeu	Cyclized	Cyclized	Anticancer	Fusarium sp.	SK-MEL-2	Skin Cancer	Not Available	IC₅₀ = 5.9 µg/ml	Not Available	Skin	None
7365	33630204	2022	DVNFLLHKIYGNIRY	LvHemB1	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	hemocyanin of Litopenaeus vannamei	EJ	Bladder Cancer	MTS assay	89.6% apoptotic cells at 50 μg/mL	24-h	Bladder	None
7367	None	2022	MDNHVCIPLCPP	MP12	12	Linear	L	None	Free	Free	Antiproliferative	Aphanomyces invadans	Hep-2	Larynx Cancer	MTT assay	IC₅₀ = 24.7 ± 0.34 μM	Not Available	Larynx	None
7363	33630204	2022	DVNFLLHKIYGNIRY	LvHemB1	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	hemocyanin of Litopenaeus vannamei	EC-109	Esophageal Cancer	MTS assay	57.1% apoptotic cells at 50 μg/mL	24-h	Esophagus	None
7364	33630204	2022	DVNFLLHKIYGNIRY	LvHemB1	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	hemocyanin of Litopenaeus vannamei	HepG-2	Liver Cancer	MTS assay	44.2% apoptotic cells at 50 μg/mL	24-h	Liver	None
7362	33630204	2022	DVNFLLHKIYGNIRY	LvHemB1	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	hemocyanin of Litopenaeus vannamei	HeLa	Cervical cancer	MTS assay	65.1% apoptotic cells at 50 μg/mL	24-h	Cervix	None
7360	35200639	2022	WYIRKIRRFFKWLKKKLKKK	P6	20	Linear	L	None	Free	Free	Antitumor	Arca inflata	SW-620	Colon Cancer	MTT assay	IC₅₀ >27 μg/mL	48-h	Colon	None
7361	35200639	2022	WYIRKIRRFFKWLKKKLKKK	P6	20	Linear	L	None	Free	Free	Antitumor	Arca inflata	L02	Colorectal Cancer	MTT assay	IC₅₀ >150 μg/mL	48-h	Colon	None
7359	35200639	2022	WYIRKIRRFFKWLKKKLKKK	P6	20	Linear	L	None	Free	Free	Antitumor	Arca inflata	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 10.88 ± 0.72 μg/mL	48-h	Colon	None
7358	35200639	2022	WYIRKIRRFFKWLKKKLKKK	P6	20	Linear	L	None	Free	Free	Antitumor	Arca inflata	DLD-1	Colorectal Cancer	MTT assay	IC₅₀ = 2.14 ± 0.28 μg/mL	48-h	Colon	None
7355	35606468	2022	GLLGKILGAGKKVLLGVSGLL	Nigrocin-M1	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Synthetic; Analogue of Nigrocin M1	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 24.60 μM	24-h	Breast	None
7357	35200639	2022	WYIRKIRRFFKWLKKKLKKK	P6	20	Linear	L	None	Free	Free	Antitumor	Arca inflata	HT-29	Colorectal Cancer	MTT assay	IC₅₀ = 4.43 ± 0.15 μg/mL	48-h	Colon	None
7354	35606468	2022	GLLGKILGAGKKVLLGVSGLL	Nigrocin-M1	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Synthetic; Analogue of Nigrocin M1	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 25.06 μM	24-h	Brain	None
7352	35606468	2022	GLLGKILGAGKKVLLGVSGLL	Nigrocin-M1	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Synthetic; Analogue of Nigrocin M1	H-157	Non-small cell lung cancer	MTT assay	IC₅₀ = 24 μM	24-h	Lung	None
7353	35606468	2022	GLLGKILGAGKKVLLGVSGLL	Nigrocin-M1	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Synthetic; Analogue of Nigrocin M1	PC-3	Prostate cancer	MTT assay	IC₅₀ = 31.27 μM	24-h	Prostate	None
7350	35606468	2022	GLLGKILGAGKKVLCGVSGLC	Nigrocin-PN	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Pelophylax nigromaculatus	PC-3	Prostate cancer	MTT assay	IC₅₀ = 53.03 μM	24-h	Prostate	None
7351	35606468	2022	GLLGKILGAGKKVLCGVSGLC	Nigrocin-PN	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Pelophylax nigromaculatus	U-251-MG	Brain Tumor	MTT assay	IC₅₀ = 73.65 μM	24-h	Brain	None
7349	35606468	2022	GLLGKILGAGKKVLCGVSGLC	Nigrocin-PN	21	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Pelophylax nigromaculatus	H-157	Non-small cell lung cancer	MTT assay	IC₅₀ = 18.04 μM	24-h	Lung	None
7347	36212827	2022	LIKKLKEYLKKLI	Lt-MAP2	13	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Synthetic; Derivative of Lataracin-3a	C1498	Blood Cancer	Cytotoxicity assay	EC₅₀ = 43.9 ± 0.5 µg/mL	24-h	Blood	None
7348	36212827	2022	LIKKLKEYLKKLI	Lt-MAP2	13	Linear	L	None	Free	Free	Antimicrobial and Antitumor	Synthetic; Derivative of Lataracin-3a	K-562	Blood Cancer	Cytotoxicity assay	EC₅₀ = 44 ± 3 µg/mL	24-h	Blood	None
7346	36426386	2022	GIFKVLKNLAKGVITSLKS	[D4K,A18K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	HT-29	Colorectal Cancer	CellTiter-Glo assay	LC₅₀ = 46 ± 12 μM	24-h	Colon	None
7344	36426386	2022	GIFKVLKNLAKGVITSLKS	[D4K,A18K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	A-549	Lung Cancer	CellTiter-Glo assay	LC₅₀ = 25 ± 1 μM	24-h	Lung	None
7345	36426386	2022	GIFKVLKNLAKGVITSLKS	[D4K,A18K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	MDA-MB-231	Breast Cancer	CellTiter-Glo assay	LC₅₀ = 31 ± 1 μM	24-h	Breast	None
7343	36426386	2022	GIFKVLKNLAKGVITSLKS	[D4K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	HT-29	Colorectal Cancer	CellTiter-Glo assay	LC₅₀ = 20 ± 1 μM	24-h	Colon	None
7341	36426386	2022	GIFKVLKNLAKGVITSLKS	[D4K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	A-549	Lung Cancer	CellTiter-Glo assay	LC₅₀ = 12 ± 1 μM	24-h	Lung	None
7342	36426386	2022	GIFKVLKNLAKGVITSLKS	[D4K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	MDA-MB-231	Breast Cancer	CellTiter-Glo assay	LC₅₀ = 15 ± 1 μM	24-h	Breast	None
7340	36426386	2022	GIFDVLKNLAKGVITSLAS	Ocellatin-3N	19	Linear	L	None	Amidation	Free	Host Defense	Leptodactylus nesiotus	HT-29	Colorectal Cancer	CellTiter-Glo assay	LC₅₀ = 69 ± 10 μM	24-h	Colon	None
7338	36426386	2022	GIFDVLKNLAKGVITSLAS	Ocellatin-3N	19	Linear	L	None	Amidation	Free	Host Defense	Leptodactylus nesiotus	A-549	Lung Cancer	CellTiter-Glo assay	LC₅₀ = 35 ± 1 μM	24-h	Lung	None
7339	36426386	2022	GIFDVLKNLAKGVITSLAS	Ocellatin-3N	19	Linear	L	None	Amidation	Free	Host Defense	Leptodactylus nesiotus	MDA-MB-231	Breast Cancer	CellTiter-Glo assay	LC₅₀ = 51 ± 16 μM	24-h	Breast	None
7336	36426386	2022	GIFDVLKNLAKGVITSLKS	[A18K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	MDA-MB-231	Breast Cancer	CellTiter-Glo assay	LC₅₀ = 69 ± 18 μM	24-h	Breast	None
7337	36426386	2022	GIFDVLKNLAKGVITSLKS	[A18K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	HT-29	Colorectal Cancer	CellTiter-Glo assay	LC₅₀ = 59 ± 4 μM	24-h	Colon	None
7335	36426386	2022	GIFDVLKNLAKGVITSLKS	[A18K]OCN-3N	19	Linear	L	None	Amidation	Free	Host Defense	Synthetic; Derivative of ocellatin-3N	A-549	Lung Cancer	CellTiter-Glo assay	LC₅₀ = 30 ± 1 μM	24-h	Lung	None
7334	35209215	2022	NGVQPKYRWWRWWRRWW	RT2	17	Linear	L	None	Amidation	Free	Antimicrobial	Crocodylus siamensis	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 29.74 μM	24-h	Colon	None
7333	35628312	2022	MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH	rScyreprocin	90	Linear	L	None	His-Tag	Free	Antimicrobial	Recombinant product of Scyreprocin	HeLa	Cervical cancer	MTS assay	IC₅₀ = 3.34 x 10⁴ µM	24-h	Cervix	None
7332	35628312	2022	MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH	rScyreprocin	90	Linear	L	None	His-Tag	Free	Antimicrobial	Recombinant product of Scyreprocin	DU-145	Prostate cancer	MTS assay	IC₅₀ = 1158.30 µM	24-h	Prostate	None
7331	35628312	2022	MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH	rScyreprocin	90	Linear	L	None	His-Tag	Free	Antimicrobial	Recombinant product of Scyreprocin	T-24	Urinary Bladder Cancer	MTS assay	IC₅₀ = 1.94 x 10⁵ µM	24-h	Bladder	None
7330	35628312	2022	MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH	rScyreprocin	90	Linear	L	None	His-Tag	Free	Antimicrobial	Recombinant product of Scyreprocin	HepG-2	Liver Cancer	MTS assay	IC₅₀ = 441.01 µM	24-h	Liver	None
7329	35628312	2022	MKEDSNILDKTAKMTKQNKALLFTAGGAAAFMAGYYYYHCNYRNPAPKKSGSTTSQDKTDAQAVQSIPSPSGNKGKESKDPKVKHHHHHH	rScyreprocin	90	Linear	L	None	His-Tag	Free	Antimicrobial	Recombinant product of Scyreprocin	H-460	Lung Cancer	MTS assay	IC₅₀ = 6.27 µM	72-h	Lung	None
7327	34999227	2022	SKVWRHWRRFWHRAHRLH	LA-C1b	18	Linear	L	Lauric acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	Not Available	Not Available	Not Available	Cervix	None
7328	34999227	2022	SKVWRHWRRFWHRAHRLH	LA-C1b	18	Linear	L	Lauric acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	A-375	Skin Cancer	Not Available	Not Available	Not Available	Skin	None
7324	34999227	2022	SKVWRHWRRFWHRAHRLH	OA-C1b	18	Linear	L	Octanoic acid acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	Not Available	Not Available	Not Available	Cervix	None
7325	34999227	2022	SKVWRHWRRFWHRAHRLH	OA-C1b	18	Linear	L	Octanoic acid acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	A-375	Skin Cancer	Not Available	Not Available	Not Available	Skin	None
7326	34999227	2022	SKVWRHWRRFWHRAHRLH	LA-C1b	18	Linear	L	Lauric acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	Not Available	Not Available	Not Available	Breast	None
7322	34999227	2022	SKVWRHWRRFWHRAHRLH	PA-C1b	18	Linear	L	Palmitic acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	A-375	Skin Cancer	Not Available	Not Available	Not Available	Skin	None
7323	34999227	2022	SKVWRHWRRFWHRAHRLH	OA-C1b	18	Linear	L	Octanoic acid acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	Not Available	Not Available	Not Available	Breast	None
7320	34999227	2022	SKVWRHWRRFWHRAHRLH	PA-C1b	18	Linear	L	Palmitic acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	Not Available	Not Available	Not Available	Breast	None
7321	34999227	2022	SKVWRHWRRFWHRAHRLH	PA-C1b	18	Linear	L	Palmitic acid conjugated to the 17th Lys-residue	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	Not Available	Not Available	Not Available	Cervix	None
7319	34999227	2022	SKVWRHWRRFWHRAHRLH	Chensinin-1b	18	Linear	L	None	Amidation	Free	Antmicrobial and Anticancer	Synthetic	A-375	Skin Cancer	Not Available	Not Available	Not Available	Skin	None
7318	34999227	2022	SKVWRHWRRFWHRAHRLH	Chensinin-1b	18	Linear	L	None	Amidation	Free	Antmicrobial and Anticancer	Synthetic	HeLa	Cervical Cancer	Not Available	Not Available	Not Available	Cervix	None
7317	34999227	2022	SKVWRHWRRFWHRAHRLH	Chensinin-1b	18	Linear	L	None	Amidation	Free	Antmicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	Not Available	Not Available	Not Available	Breast	None
7316	36555235	2022	FAKKLAKLKKKLAKLALAL	AC-P19	19	Linear	L	None	Free	Free	Anticancer	Synthetic	H-460	Lung Cancer	WST-8 assay	IC₅₀ = 49.08 µM	24-h	Lung	None
7314	36483599	2022	EQQQQQQPQNRRFRE	Q7	15	Linear	L	None	Free	Free	Anticancer	Pisum sativum	HEC-1-A	Endometrial Cancer	MTT assay	IC₅₀ = 129.82 ± 7.53 μM	48-h	Endometrium	None
7315	36555235	2022	FAKKLAKLKKKLAKLALAL	AC-P19	19	Linear	L	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	WST-8 assay	IC₅₀ = 52.14 µM	24-h	Lung	None
7313	None	2022	RRGKGGRRVTMSF	RF13	13	Linear	L	None	Free	Free	Anticancer	VSP26B of C. striatus	HEp-2	Larynx Cancer	MTT assay	IC₅₀ = 49.65 µM	24-h	Larynx	None
7312	35246758	2022	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin ZP	34	Cyclic	L	None	Cyclized	Cyclized	Antimicrobial	Lactococcus lactis	H-1299	Lung Cancer	MTT assay	IC₅₀ = 137.3 ± 9.1 μM	48-h	Lung	None
7311	35246758	2022	ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK	Nisin ZP	34	Cyclic	L	None	Cyclized	Cyclized	Antimicrobial	Lactococcus lactis	A-549	Lung Cancer	MTT assay	IC₅₀ = 132.4 ± 6.4 μM	48-h	Lung	None
7310	36555235	2022	FAKKLAKLKKKLAKLAKKR	AC-P19M	19	Linear	L	None	Free	Free	Anticancer and Antimicrobial	Synthetic analogue of AC-P19	H-460	Lung Cancer	WST-8 assay	IC₅₀ = 6.29 µM	24-h	Lung	None
7309	36555235	2022	FAKKLAKLKKKLAKLAKKR	AC-P19M	19	Linear	L	None	Free	Free	Anticancer and Antimicrobial	Synthetic analogue of AC-P19	A-549	Lung Cancer	WST-8 assay	IC₅₀ = 9.84 µM	24-h	Lung	None
7308	36183673	2022	EARPALLTSRLRFIPK	GV1001	16	Linear	L	None	Free	Free	Anticancer	Human telomerase reverse transcriptase (hTERT)	A-549	Lung Cancer	Cell Viability assay	Graph Fig 2A	24-h	Lung	None
7307	35764196	2022	kklalalakkwlalakklalalakk	D-LAK-120-A	25	Linear	D	None	Amidation	Free	Antimicrobial	Synthetic	HCC-827	Lung Adenocarcinoma	MTT assay	IC₅₀ between 4.0 and 5.5 μM	72-h	Lung	None
7306	35764196	2022	kklalalakkwlalakklalalakk	D-LAK-120-A	25	Linear	D	None	Amidation	Free	Antimicrobial	Synthetic	H-1975	Non Small Cell Lung Cancer (NSCLC)	MTT assay	IC₅₀ between 4.0 and 5.5 μM	72-h	Lung	None
7305	35764196	2022	kklalalakkwlalakklalalakk	D-LAK-120-A	25	Linear	D	None	Amidation	Free	Antimicrobial	Synthetic	H-358	Non Small Cell Lung Cancer (NSCLC)	MTT assay	IC₅₀ = 4.00 ± 0.20 μM	72-h	Lung	None
7304	35764196	2022	kklalalakkwlalakklalalakk	D-LAK-120-A	25	Linear	D	None	Amidation	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 5.55 ± 0.13 μM	72-h	Lung	None
7303	36287985	2022	IWSFLIKAATKLLPSLFGGGKKDS	SMP24	24	Linear	L	None	Free	Free	Antimicrobial	Egyptian scorpion Scorpio maurus palmatus	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 5.524 µM	24-h	Liver	None
7302	35878176	2022	IWSFLIKAATKLLPSLFGGGKKDS	SMP24	24	Linear	L	None	Free	Free	Antimicrobial	Egyptian scorpion Scorpio maurus palmatus	H-460	Lung Cancer	MTT assay	IC₅₀ = 7.07 ± 0.81 µM	24-h	Lung	None
7301	35878176	2022	IWSFLIKAATKLLPSLFGGGKKDS	SMP24	24	Linear	L	None	Free	Free	Antimicrobial	Egyptian scorpion Scorpio maurus palmatus	PC-9	Lung Cancer	MTT assay	IC₅₀ = 6.34 ± 0.53 µM	24-h	Lung	None
7300	35878176	2022	IWSFLIKAATKLLPSLFGGGKKDS	SMP24	24	Linear	L	None	Free	Free	Antimicrobial	Egyptian scorpion Scorpio maurus palmatus	H-3122	Lung Cancer	MTT assay	IC₅₀ = 4.64 ± 0.18 µM	24-h	Lung	None
7299	35878176	2022	IWSFLIKAATKLLPSLFGGGKKDS	SMP24	24	Linear	L	None	Free	Free	Antimicrobial	Egyptian scorpion Scorpio maurus palmatus	A-549	Lung Cancer	MTT assay	IC₅₀ = 4.06 ± 0.60 µM	24-h	Lung	None
7296	36713538	2022	KKWWKKW-Dip-K	NTP-217	9	Linear	L	Dip = β-diphenylalanine	Amidation	rhodamine B - GABA	Anticancer	Synthetic	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 40.1 ± 1.3 µM	4-h	Liver	None
7297	36713538	2022	KKWWKKW-Dip-K	NTP-217	9	Linear	L	Dip = β-diphenylalanine	Amidation	rhodamine B - GABA	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 48.8 ± 0.7 µM	4-h	Liver	None
7298	36713538	2022	KKWWKKW-Dip-K	NTP-217	9	Linear	L	Dip = β-diphenylalanine	Amidation	rhodamine B - GABA	Anticancer	Synthetic	Hep3B	Liver Cancer	MTT assay	IC₅₀ = 45.7 ± 1.7 µM	4-h	Liver	None
7293	36713538	2022	KKWWKKW-Dip-K	NTP-217	9	Linear	L	Dip = β-diphenylalanine	Amidation	rhodamine B - GABA	Anticancer	Synthetic	Hepa 1-6	Liver Cancer	MTT assay	IC₅₀ = 21.6 ± 1.0 µM	4-h	Liver	None
7294	36713538	2022	KKWWKKW-Dip-K	NTP-217	9	Linear	L	Dip = β-diphenylalanine	Amidation	rhodamine B - GABA	Anticancer	Synthetic	PLC/PRF/5	Liver Cancer	MTT assay	IC₅₀ = 14.6 ± 1.1 µM	4-h	Liver	None
7295	36713538	2022	KKWWKKW-Dip-K	NTP-217	9	Linear	L	Dip = β-diphenylalanine	Amidation	rhodamine B - GABA	Anticancer	Synthetic	HCCLM-3	Liver Cancer	MTT assay	IC₅₀ = 22.4 ± 5.1 µM	4-h	Liver	None
7292	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	T98G	Brain Tumor	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Brain	None
7291	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Lung	None
7290	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	DU-145	Prostate Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Prostate	None
7289	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	A-375	Skin Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Skin	None
7288	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Breast	None
7287	36121385	2022	vaeareelerlearlgqargelkkwkmrrnqfwlklqr	ST101	38	Linear	D	None	Free	Free	Anticancer	Synthetic	U-251	Brain Tumor	Annexin V/ PI staining assay	mean EC₅₀ value of 2.1 ± 0.4 μmol/L	48-h	Brain	None
7276	35601827	2022	IWLTALKFLGKNLGKLAKQQLAKL	LyeTx-I-b	24	Linear	L	None	Amidated	Acetylation	Antimicrobial	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 2.47 µM	48-h	Breast	None
7275	35013881	2022	KLKNFAKGVAQSLLNKASCKLSGQC	Brevinin-2R	25	Linear	L	None	Free	Free	Antimicrobial	Rana ridibunda	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 131.5 μg/ml	24-h	Cervix	None
7273	36186562	2022	EEEEY	C16-E4Y	5	Linear	L	None	Free	Palmitoyl	Anticancer	Synthetic	MCF-7	Breast Cancer	WST-8 assay	50 % cell viability at 0.05 wt %	24-h	Breast	None
7274	36465844	2022	GVKFAKRFWRFAKKAFKRFEK	HAZ	21	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 5.44 μM	4-h	Lung	None
7270	36186562	2022	EEEEY	C16-E4Y	5	Linear	L	None	Free	Palmitoyl	Anticancer	Synthetic	A-431	Skin Cancer	WST-8 assay	10 % cell viability at 0.05 wt %	24-h	Skin	None
7271	36186562	2022	EEEEY	C16-E4Y	5	Linear	L	None	Free	Palmitoyl	Anticancer	Synthetic	HeLa	Cervical Cancer	WST-8 assay	60% cell viability at 0.05 wt %	24-h	Cervix	None
7272	36186562	2022	EEEEY	C16-E4Y	5	Linear	L	None	Free	Palmitoyl	Anticancer	Synthetic	HepG-2	Liver Cancer	WST-8 assay	50 % cell viability at 0.05 wt %	24-h	Liver	None
7269	35631675	2022	FAKLLAKLARRLL	HB43-mut3	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	AlamarBlue assay	75% cell viability at 20 μM	Not Available	Breast	None
7268	35631675	2022	FAKLLAKLARRLL	HB43-mut3	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HT-29	Colon Cancer	AlamarBlue assay	IC₅₀ = 9 ± 1 μM	24-h	Colon	None
7266	35631675	2022	FAKLLAKLARRLL	HB43-mut3	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	SW-480	Colon Cancer	AlamarBlue assay	IC₅₀ = 8 ± 1 μM	24-h	Colon	None
7267	35631675	2022	FAKLLAKLARRLL	HB43-mut3	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	SW-620	Colon Cancer	AlamarBlue assay	IC₅₀ = 9 ± 1 μM	24-h	Colon	None
7265	35631675	2022	FAKLLAKLAKLLK	HB43-mut2	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	AlamarBlue assay	80% cell viability at 20 μM	Not Available	Breast	None
7263	35631675	2022	FAKLLAKLAKLLK	HB43-mut2	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	SW-620	Colon Cancer	AlamarBlue assay	IC₅₀ = 40 ± 3 μM	24-h	Colon	None
7264	35631675	2022	FAKLLAKLAKLLK	HB43-mut2	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HT-29	Colon Cancer	AlamarBlue assay	IC₅₀ = 50 ± 3 μM	24-h	Colon	None
7262	35631675	2022	FAKLLAKLAKLLK	HB43-mut2	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	SW-480	Colon Cancer	AlamarBlue assay	IC₅₀ = 34 ± 2 μM	24-h	Colon	None
7261	35631675	2022	FAKLLAKLAKKLL	HB43	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	AlamarBlue assay	50% cell viability at 20 μM	Not Available	Breast	None
7259	35631675	2022	FAKLLAKLAKKLL	HB43	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	SW-620	Colon Cancer	AlamarBlue assay	IC₅₀ = 10 ± 1 μM	24-h	Colon	None
7260	35631675	2022	FAKLLAKLAKKLL	HB43	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HT-29	Colon Cancer	AlamarBlue assay	IC₅₀ = 11 ± 1 μM	24-h	Colon	None
7258	35631675	2022	FAKLLAKLAKKLL	HB43	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	SW-480	Colon Cancer	AlamarBlue assay	IC₅₀ = 12 ± 4 μM	24-h	Colon	None
7256	36360120	2022	GPLGAGP	HTDT-6-2-3-2	7	Linear	L	None	Free	Free	Anticancer	Enteromorpha prolifera	HepG-2	Liver Cancer	CCK-8 assay	IC₅₀ = 1.2564 ± 0.0548 mg/mL	48-h	Liver	None
7257	36360120	2022	GPLGAGP	HTDT-6-2-3-2	7	Linear	L	None	Free	Free	Anticancer	Enteromorpha prolifera	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 0.9867 ± 0.0857 mg/mL	48-h	Lung	None
7255	36360120	2022	GPLGAGP	HTDT-6-2-3-2	7	Linear	L	None	Free	Free	Anticancer	Enteromorpha prolifera	NCI-H-460	Lung Cancer	CCK-8 assay	IC₅₀ = 0.3686 ± 0.0935 mg/mL	48-h	Lung	None
7254	35774163	2022	flgvlallgylavrpflpkkkqqk	D-NAF-1	24	Linear	D	None	Free	Free	Anticancer	NAF-1/CISD2	MDA-MB-231	Breast Cancer	Not Available	IC₅₀ = 12.8 ± 0.2 μM	NA	Breast	None
7253	35774163	2022	FLGVLALLGYLAVRPFLPKKKQQK	NAF-1	24	Linear	L	None	Free	Free	Anticancer	NAF-1/CISD2	MDA-MB-231	Breast Cancer	Not Available	IC₅₀ = 18.3 ± 0.4 μM	NA	Breast	None
7252	35094208	2022	HARIKpTFRRlKWKYKGKFW	CIGB-552	20	Linear	Mix	None	Free	Acetylation	Antitumor	Synthetic	A-549	Lung Cancer	Sulforhodamine B assay	IC₅₀ = 44.6 μM	48-h	Lung	None
7251	35094208	2022	HARIKpTFRRlKWKYKGKFW	CIGB-552	20	Linear	Mix	None	Free	Acetylation	Antitumor	Synthetic	NCI-H-460	Lung Cancer	Sulforhodamine B assay	IC₅₀ = 287.9 μM	48-h	Lung	None
7250	36672551	2022	GRKKRRQRRRPPQ-X-CWMSPRHLGTC	CIGB-300	25	Cyclic	L	X = Beta- Alanine	Free	Biotinylated	Anticancer	Synthetic	NCI-H-460	Lung Cancer	Crystal Violet assay	IC₅₀ = 30 ± 5.3 µM	48-h	Lung	None
7249	35745643	2022	FKWQFEMLIMKIAKTSGFMFYSSY	BmPLA2	24	Linear	L	None	Free	Free	Anticancer	phospholipase A2 isoform from B. moojeni venom	RD	Rhabdomyosarcoma	MTT assay	60% reduction in cell viability	24-h	Muscle	None
7248	35745643	2022	FKWQFEMLIMKIAKTSGFMFYSSY	BmPLA2	24	Linear	L	None	Free	Free	Anticancer	phospholipase A2 isoform from B. moojeni venom	CaCo-2	Colorectal Cancer	MTT assay	IC₅₀ = 0.6 µM	24-h	Colon	None
7246	36174494	2022	KIIIKIKKKIKIIIK	At12	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 14.0 µM	NA	Lung	None
7247	36174494	2022	KIIIKIKKKIKIIIK	At12	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 13.4 µM	NA	Liver	None
7245	36174494	2022	IIIKKIKKKIKKIII	At11	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 7.6 µM	NA	Liver	None
7244	36174494	2022	IIIKKIKKKIKKIII	At11	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 7.9 µM	NA	Lung	None
7243	36174494	2022	IKKIIKIIKKIIKKI	At10	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 3.2 µM	NA	Liver	None
7242	36174494	2022	IKKIIKIIKKIIKKI	At10	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 4.4 µM	NA	Lung	None
7241	36174494	2022	KVVKKVKKKVKKVVK	At9	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 51.7 µM	NA	Liver	None
7240	36174494	2022	KVVKKVKKKVKKVVK	At9	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 100 µM	NA	Lung	None
7239	36174494	2022	KLLKKLKKKLKKLLK	At8	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 8.9 µM	NA	Liver	None
7238	36174494	2022	KLLKKLKKKLKKLLK	At8	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 13.4 µM	NA	Lung	None
7237	36174494	2022	KIIKKIKKKIKKIIK	At7	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 8.8 µM	NA	Liver	None
7236	36174494	2022	KIIKKIKKKIKKIIK	At7	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 10.3 µM	NA	Lung	None
7235	36174494	2022	KVVKKVVKVVKKVVK	At6	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 70.8 µM	NA	Liver	None
7234	36174494	2022	KVVKKVVKVVKKVVK	At6	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ > 100 µM	NA	Lung	None
7232	36174494	2022	KIIKKIIKIIKKIIK	At5	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 3.6 µM	NA	Lung	None
7233	36174494	2022	KIIKKIIKIIKKIIK	At5	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 1.5 µM	NA	Liver	None
7231	36174494	2022	KLLKKLLKLLKKLLK	At4	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 2.5 µM	NA	Liver	None
7230	36174494	2022	KLLKKLLKLLKKLLK	At4	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 7.2 µM	NA	Lung	None
7228	36174494	2022	KLLKKVVKLFKKLLK	Ponericin-W1 (11-25) [P4K; S5K; G8K; K13L; Q15K], At3	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 4.3 µM	NA	Lung	None
7229	36174494	2022	KLLKKVVKLFKKLLK	Ponericin-W1 (11-25) [P4K; S5K; G8K; K13L; Q15K], At3	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 2.2 µM	NA	Liver	None
7227	36174494	2022	KLLKKVVKLFKKKKK	Ponericin-W1 (11-25) [P4K; S5K; G8K; Q15K], At2	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ >100 µM	NA	Liver	None
7226	36174494	2022	KLLKKVVKLFKKKKK	Ponericin-W1 (11-25) [P4K; S5K; G8K; Q15K], At2	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ >100 µM	NA	Lung	None
7224	36174494	2022	KLLPSVVGLFKKKKQ	Ponericin-W1 (11-25), At1	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ > 100 µM	NA	Lung	None
7225	36174494	2022	KLLPSVVGLFKKKKQ	Ponericin-W1 (11-25), At1	15	Linear	L	None	Amidation	Acetylation	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ >100 µM	NA	Liver	None
7223	35190586	2022	MADSERLSAPGCWAACTNFSRTRK	RB4	24	Linear	L	None	Amidation	Free	Anticancer	Derived from protein PLP2	MCF-7	Breast Cancer	MTT assay	EC₅₀ = 0.724 ± 0.340 mol/L × 10^-3	24-h	Breast	None
7222	35190586	2022	MADSERLSAPGCWAACTNFSRTRK	RB4	24	Linear	L	None	Amidation	Free	Anticancer	Derived from protein PLP2	A-2058	Skin Cancer	MTT assay	EC₅₀ = 0.744 ± 0.208 mol/L × 10^-3	24-h	Skin	None
7221	35190586	2022	MADSERLSAPGCWAACTNFSRTRK	RB4	24	Linear	L	None	Amidation	Free	Anticancer	Derived from protein PLP2	U-87	Brain Tumor	MTT assay	EC₅₀ = 0.427 ± 0.053 mol/L × 10^-3	24-h	Brain	None
7220	35190586	2022	MADSERLSAPGCWAACTNFSRTRK	RB4	24	Linear	L	None	Amidation	Free	Anticancer	Derived from protein PLP2	HeLa	Cervical Cancer	MTT assay	EC₅₀ = 0.525 ± 0.160 mol/L × 10^-3	24-h	Cervix	None
7219	35190586	2022	MADSERLSAPGCWAACTNFSRTRK	RB4	24	Linear	L	None	Amidation	Free	Anticancer	Derived from protein PLP2	B16-F10-Nex 2	Skin Cancer	MTT assay	EC₅₀ = 0.263 ± 0.585 mol/L × 10^-3	24-h	Skin	None
7218	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple-a	25	Linear	L	None	Amidation	Free	Antimicrobial	C-terminal-amidated derivative of Pleurocidin	WiDr	Colon Cancer	MTT assay	IC₅₀ = 197.3 μM	24-h	Colon	None
7217	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple-a	25	Linear	L	None	Amidation	Free	Antimicrobial	C-terminal-amidated derivative of Pleurocidin	AGS	Stomach Cancer	MTT assay	IC₅₀ = 29.8 μM	24-h	Stomach	None
7216	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple-a	25	Linear	L	None	Amidation	Free	Antimicrobial	C-terminal-amidated derivative of Pleurocidin	A-549	Lung Cancer	MTT assay	IC₅₀ = 42.1 μM	24-h	Lung	None
7215	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple-a	25	Linear	L	None	Amidation	Free	Antimicrobial	C-terminal-amidated derivative of Pleurocidin	Hep3B	Liver Cancer	MTT assay	IC₅₀ = 77.5 μM	24-h	Liver	None
7214	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple-a	25	Linear	L	None	Amidation	Free	Antimicrobial	C-terminal-amidated derivative of Pleurocidin	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 60 μM	24-h	Liver	None
7213	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple-a	25	Linear	L	None	Amidation	Free	Antimicrobial	C-terminal-amidated derivative of Pleurocidin	J5	Liver Cancer	MTT assay	IC₅₀ = 11 μM	24-h	Liver	None
7212	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple	25	Linear	L	None	Free	Free	Antimicrobial	Pleuronectes americanus	AGS	Stomach Cancer	MTT assay	IC₅₀ = 186.5 μM	24-h	Stomach	None
7211	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple	25	Linear	L	None	Free	Free	Antimicrobial	Pleuronectes americanus	A-549	Lung Cancer	MTT assay	IC₅₀ = 300.8 μM	24-h	Lung	None
7210	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple	25	Linear	L	None	Free	Free	Antimicrobial	Pleuronectes americanus	Hep3B	Liver Cancer	MTT assay	IC₅₀ = 340.9 μM	24-h	Liver	None
7209	36005521	2022	GWGSFFKKAAHVGKHVGKAALTHYL	Ple	25	Linear	L	None	Free	Free	Antimicrobial	Pleuronectes americanus	J5	Liver Cancer	MTT assay	IC₅₀ = 54.9 μM	24-h	Liver	None
7208	34679257	2022	WRRRYRRWRRRRRWRRRPRR	vCPP2319	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	SK-BR-3	Breast Cancer	MTT assay	IC₅₀ = 14.0 ± 1.0 μM	24-h	Breast	None
7207	34679257	2022	WRRRYRRWRRRRRWRRRPRR	vCPP2319	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-474	Breast Cancer	MTT assay	IC₅₀ = 15.7 ± 1.5 μM	24-h	Breast	None
7206	34679257	2022	WRRRYRRWRRRRRWRRRPRR	vCPP2319	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-20	Breast Cancer	MTT assay	IC₅₀ = 4.2 ± 2.2 μM	24-h	Breast	None
7205	34679257	2022	WRRRYRRWRRRRRWRRRPRR	vCPP2319	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 4.5 ± 0.1 μM	24-h	Breast	None
7204	34679257	2022	RRLTLRQLLGLGSRRRRRSR	vCPP0769	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	SK-BR-3	Breast Cancer	MTT assay	IC₅₀ = 21.1 ± 2.0 μM	24-h	Breast	None
7203	34679257	2022	RRLTLRQLLGLGSRRRRRSR	vCPP0769	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-474	Breast Cancer	MTT assay	IC₅₀ = 37.5 ± 1.7 μM	24-h	Breast	None
7202	34679257	2022	RRLTLRQLLGLGSRRRRRSR	vCPP0769	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-20	Breast Cancer	MTT assay	IC₅₀ = 3.5 ± 1.5 μM	24-h	Breast	None
7201	34679257	2022	RRLTLRQLLGLGSRRRRRSR	vCPP0769	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 9.0 ± 0.1 μM	24-h	Breast	None
7200	34679257	2022	RPRRRATTRRRITTGTRRRR	vCPP0667	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	SK-BR-3	Breast Cancer	MTT assay	IC₅₀ = 71.2 ± 1.1 μM	24-h	Breast	None
7199	34679257	2022	RPRRRATTRRRITTGTRRRR	vCPP0667	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-474	Breast Cancer	MTT assay	IC₅₀ = 92.8 ± 1.1 μM	24-h	Breast	None
7198	34679257	2022	RPRRRATTRRRITTGTRRRR	vCPP0667	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-20	Breast Cancer	MTT assay	IC₅₀ = 88.8 ± 1.0 μM	24-h	Breast	None
7197	34679257	2022	KKRYKKKYKAYKPYKKKKKF	vCPP0275	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	SK-BR-3	Breast Cancer	MTT assay	IC₅₀ = 34.0 ± 1.0 μM	24-h	Breast	None
7196	34679257	2022	KKRYKKKYKAYKPYKKKKKF	vCPP0275	20	Linear	L	None	Amidation	Free	Anticancer and Cell Penetrating	Capsid protein of the Torque teno douroucouli virus	BT-20	Breast Cancer	MTT assay	IC₅₀ = 44.8 ± 1.1 μM	24-h	Breast	None
7195	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	SNB-19	Brain Tumor	CCK-8 assay	IC₅₀ = 12.0 ± 0.6 μM	72-h	Brain	None
7194	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	SF-268	Brain Tumor	CCK-8 assay	IC₅₀ = 4.8 ± 0.1 μM	72-h	Brain	None
7193	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	U-138	Brain Tumor	CCK-8 assay	IC₅₀ = 7.5 ± 0.3 μM	72-h	Brain	None
7192	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	LN229	Brain Tumor	CCK-8 assay	IC₅₀ = 4.7 ± 0.2 μM	72-h	Brain	None
7191	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	SW-1783	Brain Tumor	CCK-8 assay	IC₅₀ = 4.8 ± 0.2 μM	72-h	Brain	None
7190	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	D54	Brain Tumor	CCK-8 assay	IC₅₀ = 8.4 ± 0.1 μM	72-h	Brain	None
7189	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	U-118	Brain Tumor	CCK-8 assay	IC₅₀ = 6.8 ± 0.2 μM	72-h	Brain	None
7188	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	U-373	Brain Tumor	CCK-8 assay	IC₅₀ = 5.0 ± 0.2 μM	72-h	Brain	None
7187	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	T98G	Brain Tumor	CCK-8 assay	IC₅₀ = 7.1 ± 0.2 μM	96-h	Brain	None
7186	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	A-172	Brain Tumor	CCK-8 assay	IC₅₀ = 6.4 ± 0.4 μM	96-h	Brain	None
7185	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	U-251	Brain Tumor	CCK-8 assay	IC₅₀ = 4.9 ± 0.3 μM	96-h	Brain	None
7184	35053455	2022	MDRWLVKWKKKRKIRRRRRRRRRRR	ATX-101	25	Linear	L	None	Free	Acetylation	Antitumor and Cell Penetrating	Synthetic	U87-MG	Brain Tumor	CCK-8 assay	IC₅₀ = 4.3 ± 0.3 μM	96-h	Brain	None
7183	35660629	2022	GRRKRKWLRRIGKGVKIIGGAALDHL	NRC-03	26	Linear	L	None	Amidation	Free	Antimicrobial	skin mucous secretions of winter flounder	SCC-9	Oral Cancer	CCK-8 assay	IC₅₀ = 45 μg/ml	24-h	Tongue	None
7181	34509120	2022	LC-Propargyl-GIIKKIIKKIIKKII	GI-15	17	Linear	L	None	Amidation	LC-Propargylglycine	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 16.6 ± 0.8 µM	72-h	Cervix	None
7182	35660629	2022	GRRKRKWLRRIGKGVKIIGGAALDHL	NRC-03	26	Linear	L	None	Amidation	Free	Antimicrobial	skin mucous secretions of winter flounder	CAL-27	Oral Cancer	CCK-8 assay	IC₅₀ = 45 μg/ml	24-h	Tongue	None
7180	34509120	2022	LC-Propargyl-GIIKKIIKKIIKKII	GI-15	17	Linear	L	None	Amidation	LC-Propargylglycine	Anticancer	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 13.6 ± 0.2 µM	72-h	Colon	None
7178	34509120	2022	CIIKKIIKKIIKKII	CI-15	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 7.7 ± 0.2 µM	72-h	Colon	None
7179	34509120	2022	CIIKKIIKKIIKKII	CI-15	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 2.7 ± 0.5 µM	72-h	Cervix	None
7177	34509120	2022	CLLRRLLRRLLRR	LR13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 26.7 ± 1.3 µM	72-h	Cervix	None
7176	34509120	2022	CLLRRLLRRLLRR	LR13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 15.6 ± 1.0 µM	72-h	Colon	None
7174	34509120	2022	CIIRRIIRRIIRR	IR13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ > 100 µM	72-h	Colon	None
7175	34509120	2022	CIIRRIIRRIIRR	IR13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ > 100 µM	72-h	Cervix	None
7173	34509120	2022	CLLKKLLKKLLKK	LK13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 83 ± 9 µM	72-h	Cervix	None
7171	34509120	2022	CIIKKIIKKIIKK	IK13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 47±5 µM	72-h	Cervix	None
7172	34509120	2022	CLLKKLLKKLLKK	LK13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 23 ± 2 µM	72-h	Colon	None
7169	35323457	2022	lPlPl	Z-8	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 15.88 ± 1.42 µg/ml	NA	Lung	None
7170	34509120	2022	CIIKKIIKKIIKK	IK13	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 29 ± 6 µM	72-h	Colon	None
7167	35323457	2022	lPlPl	Z-8	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 20.16 ± 2.24 µg/ml	NA	Breast	None
7168	35323457	2022	lPlPl	Z-8	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 7.97 ± 0.61 µg/ml	NA	Cervix	None
7164	35323457	2022	LPlPl	Z-7	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 9.97 ± 1.00 µg/ml	NA	Lung	None
7165	35323457	2022	lPlPl	Z-8	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 7.82 ± 1.18 µg/ml	NA	Breast	None
7166	35323457	2022	lPlPl	Z-8	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 9.00 ± 0.83 µg/ml	NA	Liver	None
7162	35323457	2022	LPlPl	Z-7	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 16.52 ± 1.7 µg/ml	NA	Breast	None
7163	35323457	2022	LPlPl	Z-7	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 18.21 ± 1.35 µg/ml	NA	Cervix	None
7160	35323457	2022	LPlPl	Z-7	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 13.28 ± 3.28 µg/ml	NA	Breast	None
7161	35323457	2022	LPlPl	Z-7	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 13.85 ± 1.99 µg/ml	NA	Liver	None
7157	35323457	2022	lPLPl	Z-6	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 4.59 ± 0.27 µg/ml	NA	Breast	None
7158	35323457	2022	lPLPl	Z-6	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 5.69 ± 0.37 µg/ml	NA	Cervix	None
7159	35323457	2022	lPLPl	Z-6	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 5.96 ± 0.41 µg/ml	NA	Lung	None
7155	35323457	2022	lPLPl	Z-6	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 1.65 ± 0.3 µg/ml	NA	Breast	None
7156	35323457	2022	lPLPl	Z-6	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 2.91 ± 0.17 µg/ml	NA	Liver	None
7153	35323457	2022	LPLPl	Z-5	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 12.12 ± 0.95 µg/ml	NA	Cervix	None
7154	35323457	2022	LPLPl	Z-5	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 9.5 ± 1.13 µg/ml	NA	Lung	None
7150	35323457	2022	LPlPL	Z-4	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 13.43 ± 1.96 µg/ml	NA	Breast	None
7151	35323457	2022	LPLPl	Z-5	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 14.98 ± 0.93 µg/ml	NA	Liver	None
7152	35323457	2022	LPLPl	Z-5	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 8.48 ± 1.12 µg/ml	NA	Breast	None
7148	35323457	2022	LPlPL	Z-4	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 7.38 ± 0.83 µg/ml	NA	Cervix	None
7149	35323457	2022	LPlPL	Z-4	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 9.85 ± 0.95 µg/ml	NA	Lung	None
7145	35323457	2022	lPLPL	Z-3	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 4.88 ± 0.58 µg/ml	NA	Breast	None
7146	35323457	2022	LPlPL	Z-4	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 15.23 ± 1.14 µg/ml	NA	Liver	None
7147	35323457	2022	LPlPL	Z-4	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 22.09 ± 1.12 µg/ml	NA	Breast	None
7143	35323457	2022	lPLPL	Z-3	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 5.57 ± 0.45 µg/ml	NA	Cervix	None
7144	35323457	2022	lPLPL	Z-3	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 6.43 ± 0.43 µg/ml	NA	Lung	None
7141	35323457	2022	lPLPL	Z-3	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 5.05 ± 0.45 µg/ml	NA	Liver	None
7142	35323457	2022	lPLPL	Z-3	5	Cyclic	Mix	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 6.34 ± 0.6 µg/ml	NA	Breast	None
7138	35323457	2022	LPLPL	Z-2	5	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 14.5 ± 0.36 µg/ml	NA	Cervix	None
7139	35323457	2022	LPLPL	Z-2	5	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 7.97 ± 2.06 µg/ml	NA	Lung	None
7140	35323457	2022	LPLPL	Z-2	5	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 2.25 ± 0.42 µg/ml	NA	Breast	None
7136	35323457	2022	LPLPL	Z-2	5	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 11.95 ± 0.64 µg/ml	NA	Liver	None
7137	35323457	2022	LPLPL	Z-2	5	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 14.45 ± 1.1 µg/ml	NA	Breast	None
7134	35323457	2022	L(N-Me-L)LPL	Z-1	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 4.92 ± 0.84 µg/ml	NA	Lung	None
7135	35323457	2022	LPLPL	Z-2	5	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 4.68 ± 1.22 µg/ml	NA	Breast	None
7132	35323457	2022	L(N-Me-L)LPL	Z-1	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 17.81 ± 0.6 µg/ml	NA	Breast	None
7133	35323457	2022	L(N-Me-L)LPL	Z-1	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 11.56 ± 0.65 µg/ml	NA	Cervix	None
7130	35323457	2022	L(N-Me-L)LPL	Z-1	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 5.85 ± 1.28 µg/ml	NA	Breast	None
7131	35323457	2022	L(N-Me-L)LPL	Z-1	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Synthetic	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 7.57 ± 0.17 µg/ml	NA	Liver	None
7128	35323457	2022	(N-Me-L)L(N-Me-L)LL	Galaxamide	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Galaxaura ﬁlamentosa	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 8.73 ± 0.29 µg/ml	NA	Breast	None
7129	35323457	2022	(N-Me-L)L(N-Me-L)LL	Galaxamide	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Galaxaura ﬁlamentosa	A-549	Lung Cancer	MTT assay	IC₅₀ = 6.99 ± 0.63 µg/ml	NA	Lung	None
7126	35323457	2022	(N-Me-L)L(N-Me-L)LL	Galaxamide	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Galaxaura ﬁlamentosa	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 11.33 ± 2.95 µg/ml	NA	Breast	None
7127	35323457	2022	(N-Me-L)L(N-Me-L)LL	Galaxamide	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Galaxaura ﬁlamentosa	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 8.53 ± 0.73 µg/ml	NA	Cervix	None
7125	35323457	2022	(N-Me-L)L(N-Me-L)LL	Galaxamide	5	Cyclic	L	N-Me-L = N-methyl-Lysine	Cyclized	Cyclized	Anticancer	Galaxaura ﬁlamentosa	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 5.20 ± 0.52 µg/ml	NA	Liver	None
7123	35740884	2022	FLPLiiGALSSLLPKiF	Temporin-PKE-3i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 72.06 μM	24-h	Colon	None
7124	35740884	2022	FLPLiiGALSSLLPKiF	Temporin-PKE-3i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	H-157	Lung Cancer	MTT assay	IC₅₀ = 71.18 μM	24-h	Lung	None
7122	35740884	2022	FLPLiiGALSSLLPKiF	Temporin-PKE-3i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	H-838	Lung Cancer	MTT assay	IC₅₀ = 193.4 μM	24-h	Lung	None
7121	35740884	2022	FLPLiiGALSSLLPKiF	Temporin-PKE-3i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 167 μM	24-h	Prostate	None
7120	35740884	2022	FLPLiiGALSSLLPKiF	Temporin-PKE-3i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 120.6 μM	24-h	Brain	None
7119	35740884	2022	FLPLIIGALSSLLPKiF	Temporin-PKE-i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	H-157	Lung Cancer	MTT assay	IC₅₀ = 2.94 μM	24-h	Lung	None
7117	35740884	2022	FLPLIIGALSSLLPKiF	Temporin-PKE-i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	H-838	Lung Cancer	MTT assay	IC₅₀ = 5.28 μM	24-h	Lung	None
7118	35740884	2022	FLPLIIGALSSLLPKiF	Temporin-PKE-i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 3.07 μM	24-h	Colon	None
7116	35740884	2022	FLPLIIGALSSLLPKiF	Temporin-PKE-i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 3.35 μM	24-h	Prostate	None
7115	35740884	2022	FLPLIIGALSSLLPKiF	Temporin-PKE-i	17	Linear	Mix	None	Amidation	Free	Antimicrobial	Synthetic	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 4.46 μM	24-h	Brain	None
7114	35740884	2022	FLPKIIGKLSSKLPKIF	Temporin-PKE-4K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-157	Lung Cancer	MTT assay	IC₅₀ = 27.76 μM	24-h	Lung	None
7113	35740884	2022	FLPKIIGKLSSKLPKIF	Temporin-PKE-4K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 99.36 μM	24-h	Colon	None
7111	35740884	2022	FLPKIIGKLSSKLPKIF	Temporin-PKE-4K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 49.50 μM	24-h	Prostate	None
7112	35740884	2022	FLPKIIGKLSSKLPKIF	Temporin-PKE-4K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-838	Lung Cancer	MTT assay	IC₅₀ = 35.28 μM	24-h	Lung	None
7110	35740884	2022	FLPKIIGKLSSKLPKIF	Temporin-PKE-4K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 85.52 μM	24-h	Brain	None
7109	35740884	2022	FLPKIIGKLSSLLPKIF	Temporin-PKE-3K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-157	Lung Cancer	MTT assay	IC₅₀ = 3.29 μM	24-h	Lung	None
7108	35740884	2022	FLPKIIGKLSSLLPKIF	Temporin-PKE-3K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 0.38 μM	24-h	Colon	None
7106	35740884	2022	FLPKIIGKLSSLLPKIF	Temporin-PKE-3K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 3.01 μM	24-h	Prostate	None
7107	35740884	2022	FLPKIIGKLSSLLPKIF	Temporin-PKE-3K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-838	Lung Cancer	MTT assay	IC₅₀ = 0.51 μM	24-h	Lung	None
7105	35740884	2022	FLPKIIGKLSSLLPKIF	Temporin-PKE-3K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 2.83 μM	24-h	Brain	None
7103	35740884	2022	FLPLIIGALSSKLPKIF	Temporin-PKE-K12	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 22.09 μM	24-h	Colon	None
7104	35740884	2022	FLPLIIGALSSKLPKIF	Temporin-PKE-K12	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-157	Lung Cancer	MTT assay	IC₅₀ = 24.03 μM	24-h	Lung	None
7102	35740884	2022	FLPLIIGALSSKLPKIF	Temporin-PKE-K12	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-838	Lung Cancer	MTT assay	IC₅₀ = 22.67 μM	24-h	Lung	None
7101	35740884	2022	FLPLIIGALSSKLPKIF	Temporin-PKE-K12	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 27.32 μM	24-h	Prostate	None
7100	35740884	2022	FLPLIIGALSSKLPKIF	Temporin-PKE-K12	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 25.75 μM	24-h	Brain	None
7099	35740884	2022	FLPLIIGKLSSLLPKIF	Temporin-PKE-2K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-157	Lung Cancer	MTT assay	IC₅₀ = 2.78 μM	24-h	Lung	None
7098	35740884	2022	FLPLIIGKLSSLLPKIF	Temporin-PKE-2K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 2.84 μM	24-h	Colon	None
7097	35740884	2022	FLPLIIGKLSSLLPKIF	Temporin-PKE-2K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	H-838	Lung Cancer	MTT assay	IC₅₀ = 3.07 μM	24-h	Lung	None
7096	35740884	2022	FLPLIIGKLSSLLPKIF	Temporin-PKE-2K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 2.64 μM	24-h	Prostate	None
7095	35740884	2022	FLPLIIGKLSSLLPKIF	Temporin-PKE-2K	17	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 2.49 μM	24-h	Brain	None
7094	35740884	2022	FLPLIIGALSSLLPKIF	Temporin-PKE	17	Linear	L	None	Amidation	Free	Antimicrobial	skin secretion of Pelophylax kl. esculentus	H-157	Lung Cancer	MTT assay	IC₅₀ = 17.40 μM	24-h	Lung	None
7093	35740884	2022	FLPLIIGALSSLLPKIF	Temporin-PKE	17	Linear	L	None	Amidation	Free	Antimicrobial	skin secretion of Pelophylax kl. esculentus	HCT-116	Colorectal Cancer	MTT assay	IC₅₀ = 21.31 μM	24-h	Colon	None
7092	35740884	2022	FLPLIIGALSSLLPKIF	Temporin-PKE	17	Linear	L	None	Amidation	Free	Antimicrobial	skin secretion of Pelophylax kl. esculentus	H-838	Lung Cancer	MTT assay	IC₅₀ = 16.38 μM	24-h	Lung	None
7091	35740884	2022	FLPLIIGALSSLLPKIF	Temporin-PKE	17	Linear	L	None	Amidation	Free	Antimicrobial	skin secretion of Pelophylax kl. esculentus	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 7.29 μM	24-h	Prostate	None
7089	35740895	2022	FLSGIVGMLaKLF-jeff-FLSGIVGMLaKLF	Jeff-[G10a]₂-SHa	26	Linear	Mix	Jeffamine linker	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MNT-1	Skin Cancer	Resazurin dye assay	IC₅₀ = 57.03 ± 6.09 µM	48-h	Skin	US_10550155_B2
7090	35740884	2022	FLPLIIGALSSLLPKIF	Temporin-PKE	17	Linear	L	None	Amidation	Free	Antimicrobial	skin secretion of Pelophylax kl. esculentus	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 23.24 μM	24-h	Brain	None
7088	35740895	2022	FLSGIVGMLaKLF-jeff-FLSGIVGMLaKLF	Jeff-[G10a]₂-SHa	26	Linear	Mix	Jeffamine linker	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	PC-3	Prostate Cancer	Resazurin dye assay	IC₅₀ = 57.99 ± 5.04 µM	48-h	Prostate	US_10550155_B2
7086	35740895	2022	FLSGIVGMLaKLF-jeff-FLSGIVGMLaKLF	Jeff-[G10a]₂-SHa	26	Linear	Mix	Jeffamine linker	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-2780	Ovarian Cancer	Resazurin dye assay	IC₅₀ = 33.92 ± 5.90 µM	48-h	Ovary	US_10550155_B2
7087	35740895	2022	FLSGIVGMLaKLF-jeff-FLSGIVGMLaKLF	Jeff-[G10a]₂-SHa	26	Linear	Mix	Jeffamine linker	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MiaPaCa.2	Pancreatic Cancer	Resazurin dye assay	IC₅₀ = 57.45 ± 6.03 µM	48-h	Pancreas	US_10550155_B2
7084	35740895	2022	FLSGIVGMLaKLF-jeff-FLSGIVGMLaKLF	Jeff-[G10a]₂-SHa	26	Linear	Mix	Jeffamine linker	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MCF-7	Breast Cancer	Resazurin dye assay	IC₅₀ = 35.71 ± 8.50 µM	48-h	Breast	US_10550155_B2
7085	35740895	2022	FLSGIVGMLaKLF-jeff-FLSGIVGMLaKLF	Jeff-[G10a]₂-SHa	26	Linear	Mix	Jeffamine linker	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-549	Lung Cancer	Resazurin dye assay	IC₅₀ = 70.71 ± 5.39 µM	48-h	Lung	US_10550155_B2
7082	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	PC-3	Prostate Cancer	Resazurin dye assay	IC₅₀ = 1.84 ± 0.17 µM	48-h	Prostate	US_10550155_B2
7083	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MNT-1	Skin Cancer	Resazurin dye assay	IC₅₀ = 2.24 ± 0.05 µM	48-h	Skin	US_10550155_B2
7080	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-2780	Ovarian Cancer	Resazurin dye assay	IC₅₀ = 2.31 ± 0.08 µM	48-h	Ovary	US_10550155_B2
7081	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MiaPaCa.2	Pancreatic Cancer	Resazurin dye assay	IC₅₀ = 6.94 ± 0.27 µM	48-h	Pancreas	US_10550155_B2
7079	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-549	Lung Cancer	Resazurin dye assay	IC₅₀ = 3.74 ± 3.46 µM	48-h	Lung	US_10550155_B2
7077	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MCF-7	Breast Cancer	Resazurin dye assay	IC₅₀ = 3.77 ± 0.12 µM	48-h	Breast	US_10550155_B2
7078	35740895	2022	FLSGIVGMLaKLFFLSGIVGMLaKLFFLSGIVGMLaKLFKK	[G10a]₃-SHa	41	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	HepG-2	Liver Cancer	Resazurin dye assay	IC₅₀ = 5.49 ± 0.37 µM	48-h	Liver	US_10550155_B2
7076	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MNT-1	Skin Cancer	Resazurin dye assay	IC₅₀ = 4.72 ± 0.36 µM	48-h	Skin	US_10550155_B2
7075	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	PC-3	Prostate Cancer	Resazurin dye assay	IC₅₀ = 6.31 ± 0.66 µM	48-h	Prostate	US_10550155_B2
7074	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MiaPaCa.2	Pancreatic Cancer	Resazurin dye assay	IC₅₀ = 8.71 ± 0.35 µM	48-h	Pancreas	US_10550155_B2
7073	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-2780	Ovarian Cancer	Resazurin dye assay	IC₅₀ = 4.42 ± 0.06 µM	48-h	Ovary	US_10550155_B2
7072	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-549	Lung Cancer	Resazurin dye assay	IC₅₀ = 3.79 ± 1.61 µM	48-h	Lung	US_10550155_B2
7071	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	HepG-2	Liver Cancer	Resazurin dye assay	IC₅₀ = 14.31 ± 1.37 µM	48-h	Liver	US_10550155_B2
7070	35740895	2022	FLSGIVGMLaKLFKFLKaLMFLSGIVG	[G10a]₂-SHa	27	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MCF-7	Breast Cancer	Resazurin dye assay	IC₅₀ = 5.69 ± 1.46 µM	48-h	Breast	US_10550155_B2
7069	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MNT-1	Skin Cancer	Resazurin dye assay	IC₅₀ = 15.25 ± 0.80 µM	48-h	Skin	US_10550155_B2
7068	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	PC-3	Prostate Cancer	Resazurin dye assay	IC₅₀ = 13.04 ± 1.99 µM	48-h	Prostate	US_10550155_B2
7067	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MiaPaCa.2	Pancreatic Cancer	Resazurin dye assay	IC₅₀ = 22.36 ± 6.07 µM	48-h	Pancreas	US_10550155_B2
7066	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-2780	Ovarian Cancer	Resazurin dye assay	IC₅₀ = 14.75 ± 7.35 µM	48-h	Ovary	US_10550155_B2
7065	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	A-549	Lung Cancer	Resazurin dye assay	IC₅₀ = 14.52 ± 1.44 µM	48-h	Lung	US_10550155_B2
7064	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	HepG-2	Liver Cancer	Resazurin dye assay	IC₅₀ = 31.63 ± 1.56 µM	48-h	Liver	US_10550155_B2
7063	35740895	2022	FLSGIVGMLaKLF	[G10a]-SHa	13	Linear	Mix	None	Amidation	Free	Antimicrobial and Anticancer	Analog of temporin SHa	MCF-7	Breast Cancer	Resazurin dye assay	IC₅₀ = 15.05 ± 8.51 µM	48-h	Breast	US_10550155_B2
7061	35631515	2022	KKKKFFFFFFKKKK	K4F6K4	14	Linear	L	None	Free	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	AnnexinV-FITC/PI double staining assay	apoptotic cells (early and late) increased from 9.59 ± 1.00% to 43.03 ± 2.13%	12-h	Lung	None
7060	35631515	2022	KKKKFFFFFFFFKKKK	K4F8K4	16	Linear	L	None	Free	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 571.87 ± 66.23 μg/mL	48-h	Lung	None
7059	35631515	2022	KKKKFFFFFFKKKK	K4F6K4	14	Linear	L	None	Free	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 62.64 ± 9.55 μg/mL	48-h	Lung	None
7057	35631515	2022	KKFFFFFFKK	K2F6K2	10	Linear	L	None	Free	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 1146.23 ± 346.83 μg/mL	48-h	Lung	None
7058	35631515	2022	KKKFFFFFFKKK	K3F6K3	12	Linear	L	None	Free	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 123.10 ± 35.19 μg/mL	48-h	Lung	None
7056	36364156	2022	PTECQVGTTCKVES	PS14	14	Linear	L	None	Free	Free	Anticancer and Anti-inflammatory	Aphanomyces invadans	Hep-2	Larynx Cancer	LDH leakage assay	45.56 ± 2% LDH release at 20 µM	24-h	Larynx	None
7055	36364155	2022	PTECQVGTTCKVES	PS14	14	Linear	L	None	Free	Free	Anticancer and Anti-inflammatory	Aphanomyces invadans	Hep-2	Larynx Cancer	MTT assay	IC₅₀ = 21 µM	24-h	Larynx	None
7054	35246961	2022	GllellelllkaaGw	d-EEK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 4.78 ± 0.02 µM	72-h	Bone	None
7053	35246961	2022	GllellelllkaaGw	d-EEK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 0.29 ± 0.01 µM	72-h	Breast	None
7052	35246961	2022	GllellelllkaaGw	d-EEK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 0.29 ± 0.01 µM	72-h	Breast	None
7051	35246961	2022	GlldllelllkaaGw	d-DEK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 5.84 ± 0.04 µM	72-h	Bone	None
7050	35246961	2022	GlldllelllkaaGw	d-DEK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 0.36 ± 0 µM	72-h	Breast	None
7049	35246961	2022	GlldllelllkaaGw	d-DEK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 0.44 ± 0.10 µM	72-h	Breast	None
7048	35246961	2022	GlldllhlllkaaGw	d-DHK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 1.24 ± 0.03 µM	72-h	Bone	None
7046	35246961	2022	GlldllhlllkaaGw	d-DHK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 0.32 ± 0.07 µM	72-h	Breast	None
7047	35246961	2022	GlldllhlllkaaGw	d-DHK	15	Linear	Mix	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 0.23 ± 0.04 µM	72-h	Breast	None
7045	35246961	2022	GLLKLLKLLLKAAGW	KKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 9.65 ± 1.20 µM	72-h	Bone	None
7044	35246961	2022	GLLKLLKLLLKAAGW	KKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.35 ± 0.40 µM	72-h	Breast	None
7042	35246961	2022	GLLHLLKLLLKAAGW	HKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 12.23 ± 0.11 µM	72-h	Bone	None
7043	35246961	2022	GLLKLLKLLLKAAGW	KKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.57 ± 0.24 µM	72-h	Breast	None
7041	35246961	2022	GLLHLLKLLLKAAGW	HKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.60 ± 0.42 µM	72-h	Breast	None
7039	35246961	2022	GLLELLKLLLKAAGW	EKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 12.20 ± 1.84 µM	72-h	Bone	None
7040	35246961	2022	GLLHLLKLLLKAAGW	HKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.40 ± 0.71 µM	72-h	Breast	None
7038	35246961	2022	GLLELLKLLLKAAGW	EKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.19 ± 0.40 µM	72-h	Breast	None
7037	35246961	2022	GLLELLKLLLKAAGW	EKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.72 ± 0.21 µM	72-h	Breast	None
7035	35246961	2022	GLLDLLKLLLKAAGW	DKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.20 ± 0.14 µM	72-h	Breast	None
7036	35246961	2022	GLLDLLKLLLKAAGW	DKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 10.40 ± 1.70 µM	72-h	Bone	None
7034	35246961	2022	GLLDLLKLLLKAAGW	DKK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.95 ± 0.35 µM	72-h	Breast	None
7033	35246961	2022	GLLKLLHLLLKAAGW	KHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 12.88 ± 1.24 µM	72-h	Bone	None
7031	35246961	2022	GLLKLLHLLLKAAGW	KHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.59 ± 0.92 µM	72-h	Breast	None
7032	35246961	2022	GLLKLLHLLLKAAGW	KHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.40 ± 0.14 µM	72-h	Breast	None
7030	35246961	2022	GLLHLLHLLLKAAGW	HHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 12.65 ± 1.91 µM	72-h	Bone	None
7028	35246961	2022	GLLHLLHLLLKAAGW	HHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.15 ± 0.07 µM	72-h	Breast	None
7029	35246961	2022	GLLHLLHLLLKAAGW	HHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.75 ± 0.21 µM	72-h	Breast	None
7027	35246961	2022	GLLELLHLLLKAAGW	EHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 25.00 ± 0 µM	72-h	Bone	None
7025	35246961	2022	GLLELLHLLLKAAGW	EHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.35 ± 0.35 µM	72-h	Breast	None
7026	35246961	2022	GLLELLHLLLKAAGW	EHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 0.71 ± 0.13 µM	72-h	Breast	None
7024	35246961	2022	GLLDLLHLLLKAAGW	DHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 20.45 ± 2.05 µM	72-h	Bone	None
7022	35246961	2022	GLLDLLHLLLKAAGW	DHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.75 ±0.49 µM	72-h	Breast	None
7023	35246961	2022	GLLDLLHLLLKAAGW	DHK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.02 ± 0.12 µM	72-h	Breast	None
7021	35246961	2022	GLLKLLELLLKAAGW	KEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 8.15 ± 0.49 µM	72-h	Bone	None
7019	35246961	2022	GLLKLLELLLKAAGW	KEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.60 ± 0.14 µM	72-h	Breast	None
7020	35246961	2022	GLLKLLELLLKAAGW	KEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.35 ± 0.07 µM	72-h	Breast	None
7018	35246961	2022	GLLHLLELLLKAAGW	HEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 143.20 ± 80.33 µM	72-h	Bone	None
7017	35246961	2022	GLLHLLELLLKAAGW	HEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 3.45 ± 2.19 µM	72-h	Breast	None
7016	35246961	2022	GLLHLLELLLKAAGW	HEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.35 ± 1.06 µM	72-h	Breast	None
7015	35246961	2022	GLLELLELLLKAAGW	EEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 32.88 ± 4.07 µM	72-h	Bone	None
7014	35246961	2022	GLLELLELLLKAAGW	EEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.08 ± 0.18 µM	72-h	Breast	None
7013	35246961	2022	GLLELLELLLKAAGW	EEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.10 ± 0.14 µM	72-h	Breast	None
7012	35246961	2022	GLLDLLELLLKAAGW	DEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 19.88 ± 2.65 µM	72-h	Bone	None
7011	35246961	2022	GLLDLLELLLKAAGW	DEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 0.70 ± 0.07 µM	72-h	Breast	None
7010	35246961	2022	GLLDLLELLLKAAGW	DEK	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.14 ± 0.52 µM	72-h	Breast	None
7009	35246961	2022	GLLKLLKLLLHAAGW	KKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 13.30 ± 0.99 µM	72-h	Bone	None
7008	35246961	2022	GLLKLLKLLLHAAGW	KKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.20 ± 0.42 µM	72-h	Breast	None
7007	35246961	2022	GLLKLLKLLLHAAGW	KKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.40 ± 0.85 µM	72-h	Breast	None
7006	35246961	2022	GLLHLLKLLLHAAGW	HKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 18.88 ± 1.24 µM	72-h	Bone	None
7005	35246961	2022	GLLHLLKLLLHAAGW	HKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 3.10 ± 0.57 µM	72-h	Breast	None
7004	35246961	2022	GLLHLLKLLLHAAGW	HKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.45 ± 0.21 µM	72-h	Breast	None
7003	35246961	2022	GLLELLKLLLHAAGW	EKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 23.83 ± 0.81 µM	72-h	Bone	None
7002	35246961	2022	GLLELLKLLLHAAGW	EKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.18 ± 0.31 µM	72-h	Breast	None
7001	35246961	2022	GLLELLKLLLHAAGW	EKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.75 ± 0.07 µM	72-h	Breast	None
7000	35246961	2022	GLLDLLKLLLHAAGW	DKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 21.13 ± 3.01 µM	72-h	Bone	None
6999	35246961	2022	GLLDLLKLLLHAAGW	DKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.80 ± 0.28 µM	72-h	Breast	None
6998	35246961	2022	GLLDLLKLLLHAAGW	DKH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.45 ± 0.07 µM	72-h	Breast	None
6997	35246961	2022	GLLKLLHLLLHAAGW	KHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 39.75 ± 5.30 µM	72-h	Bone	None
6996	35246961	2022	GLLKLLHLLLHAAGW	KHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 4.45 ± 0.49 µM	72-h	Breast	None
6995	35246961	2022	GLLKLLHLLLHAAGW	KHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 5.20 ± 0.71 µM	72-h	Breast	None
6994	35246961	2022	GLLHLLHLLLHAAGW	HHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 185 ± 7 µM	72-h	Bone	None
6993	35246961	2022	GLLHLLHLLLHAAGW	HHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 9.50 ± 0.99 µM	72-h	Breast	None
6991	35246961	2022	GLLELLHLLLHAAGW	EHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 117 ± 7 µM	72-h	Bone	None
6992	35246961	2022	GLLHLLHLLLHAAGW	HHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 21.10 ± 6.93 µM	72-h	Breast	None
6990	35246961	2022	GLLELLHLLLHAAGW	EHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 16.05 ± 3.18 µM	72-h	Breast	None
6989	35246961	2022	GLLELLHLLLHAAGW	EHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 25.35 ± 2.76 µM	72-h	Breast	None
6987	35246961	2022	GLLDLLHLLLHAAGW	DHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 11.90 ± 0.14 µM	72-h	Breast	None
6988	35246961	2022	GLLDLLHLLLHAAGW	DHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 55.85 ± 18.88 µM	72-h	Bone	None
6986	35246961	2022	GLLDLLHLLLHAAGW	DHH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 21.45 ± 2.47 µM	72-h	Breast	None
6985	35246961	2022	GLLKLLELLLHAAGW	KEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 49.25 ± 5.30 µM	72-h	Bone	None
6984	35246961	2022	GLLKLLELLLHAAGW	KEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.35 ± 0.07 µM	72-h	Breast	None
6983	35246961	2022	GLLKLLELLLHAAGW	KEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.30 ± 0.42 µM	72-h	Breast	None
6982	35246961	2022	GLLHLLELLLHAAGW	HEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 106 ± 14 µM	72-h	Bone	None
6981	35246961	2022	GLLHLLELLLHAAGW	HEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 10.95 ± 1.06 µM	72-h	Breast	None
6979	35246961	2022	GLLELLELLLHAAGW	EEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 19.60 ± 3.96 µM	72-h	Bone	None
6980	35246961	2022	GLLHLLELLLHAAGW	HEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 28.60 ± 10.75 µM	72-h	Breast	None
6977	35246961	2022	GLLELLELLLHAAGW	EEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.30 ± 0.14 µM	72-h	Breast	None
6978	35246961	2022	GLLELLELLLHAAGW	EEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 3.60 ± 0.85 µM	72-h	Breast	None
6976	35246961	2022	GLLDLLELLLHAAGW	DEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 36.48 ± 3.92 µM	72-h	Bone	None
6975	35246961	2022	GLLDLLELLLHAAGW	DEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 3.60 ± 0.42 µM	72-h	Breast	None
6974	35246961	2022	GLLDLLELLLHAAGW	DEH	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 5.35 ± 1.91 µM	72-h	Breast	None
6973	35246961	2022	GLLKLLKLLLEAAGW	KKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 12.75 ± 1.20 µM	72-h	Bone	None
6972	35246961	2022	GLLKLLKLLLEAAGW	KKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.70 ± 0 µM	72-h	Breast	None
6971	35246961	2022	GLLKLLKLLLEAAGW	KKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.05 ± 0.64 µM	72-h	Breast	None
6970	35246961	2022	GLLHLLKLLLEAAGW	HKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 15.95 ± 0.78 µM	72-h	Bone	None
6969	35246961	2022	GLLHLLKLLLEAAGW	HKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.90 ± 0.42 µM	72-h	Breast	None
6968	35246961	2022	GLLHLLKLLLEAAGW	HKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.70 ± 0.28 µM	72-h	Breast	None
6967	35246961	2022	GLLELLKLLLEAAGW	EKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 8.00 ± 0.71 µM	72-h	Bone	None
6966	35246961	2022	GLLELLKLLLEAAGW	EKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.30 ± 0.14 µM	72-h	Breast	None
6965	35246961	2022	GLLELLKLLLEAAGW	EKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 1.80 ± 0.28 µM	72-h	Breast	None
6964	35246961	2022	GLLDLLKLLLEAAGW	DKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 9.93 ± 0.25 µM	72-h	Bone	None
6963	35246961	2022	GLLDLLKLLLEAAGW	DKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 1.57 ± 0.33 µM	72-h	Breast	None
6962	35246961	2022	GLLDLLKLLLEAAGW	DKE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 2.10 ± 0 µM	72-h	Breast	None
6961	35246961	2022	GLLKLLHLLLEAAGW	KHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 53 ± 2.83 µM	72-h	Bone	None
6960	35246961	2022	GLLKLLHLLLEAAGW	KHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.92 ± 0.17 µM	72-h	Breast	None
6959	35246961	2022	GLLKLLHLLLEAAGW	KHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.70 ± 0.14 µM	72-h	Breast	None
6958	35246961	2022	GLLHLLHLLLEAAGW	HHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 53.25 ± 5.30 µM	72-h	Bone	None
6957	35246961	2022	GLLHLLHLLLEAAGW	HHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 10.75 ± 0.78 µM	72-h	Breast	None
6956	35246961	2022	GLLHLLHLLLEAAGW	HHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 16.70 ± 2.26 µM	72-h	Breast	None
6955	35246961	2022	GLLELLHLLLEAAGW	EHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 18.25 ± 1.06 µM	72-h	Bone	None
6954	35246961	2022	GLLELLHLLLEAAGW	EHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.55 ± 0.07 µM	72-h	Breast	None
6953	35246961	2022	GLLELLHLLLEAAGW	EHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.90 ± 0.28 µM	72-h	Breast	None
6952	35246961	2022	GLLDLLHLLLEAAGW	DHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 17.25 ± 1.06 µM	72-h	Bone	None
6951	35246961	2022	GLLDLLHLLLEAAGW	DHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.80 ± 0.14 µM	72-h	Breast	None
6950	35246961	2022	GLLDLLHLLLEAAGW	DHE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.75 ± 0.92 µM	72-h	Breast	None
6949	35246961	2022	GLLKLLELLLEAAGW	KEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 49.38 ± 13.26 µM	72-h	Bone	None
6948	35246961	2022	GLLKLLELLLEAAGW	KEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 2.05 ± 0.21 µM	72-h	Breast	None
6947	35246961	2022	GLLKLLELLLEAAGW	KEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 3.75 ± 0.78 µM	72-h	Breast	None
6946	35246961	2022	GLLHLLELLLEAAGW	HEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 47.50 ± 11 µM	72-h	Bone	None
6945	35246961	2022	GLLHLLELLLEAAGW	HEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 4.95 ± 0.49 µM	72-h	Breast	None
6944	35246961	2022	GLLHLLELLLEAAGW	HEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 6.50 ± 0.71 µM	72-h	Breast	None
6943	35246961	2022	GLLELLELLLEAAGW	EEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 78.75 ± 5.30 µM	72-h	Bone	None
6942	35246961	2022	GLLELLELLLEAAGW	EEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 10.55 ± 3.46 µM	72-h	Breast	None
6941	35246961	2022	GLLELLELLLEAAGW	EEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 6.25 ± 1.77 µM	72-h	Breast	None
6940	35246961	2022	GLLDLLELLLEAAGW	DEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	U-2 OS	Bone Cancer	MTT assay	IC₅₀ = 61.00 ± 1.41 µM	72-h	Bone	None
6939	35246961	2022	GLLDLLELLLEAAGW	DEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER-shEcad	Breast Cancer	MTT assay	IC₅₀ = 6.05 ± 2.76 µM	72-h	Breast	None
6938	35246961	2022	GLLDLLELLLEAAGW	DEE	15	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HMLER	Breast Cancer	MTT assay	IC₅₀ = 5.55 ± 0.35 µM	72-h	Breast	None
6937	36355026	2022	TFKHG	LJP-12	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.72 ± 0.05 mM	48-h	Liver	None
6935	36355026	2022	TFKHG	LJP-12	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 0.41 ± 0.04 mM	48-h	Liver	None
6936	36355026	2022	TFKHG	LJP-12	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 0.60 ± 0.08 mM	48-h	Liver	None
6934	36355026	2022	YEHSHG	LJP-11	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.70 ± 0.07 mM	48-h	Liver	None
6933	36355026	2022	YEHSHG	LJP-11	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 0.61 ± 0.07 mM	48-h	Liver	None
6931	36355026	2022	HASWEH	LJP-10	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 3.53 ± 0.34 mM	48-h	Liver	None
6932	36355026	2022	YEHSHG	LJP-11	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 0.49 ± 0.05 mM	48-h	Liver	None
6930	36355026	2022	HASWEH	LJP-10	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 2.69 ± 0.22 mM	48-h	Liver	None
6928	36355026	2022	FEHSG	LJP-9	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.51 ± 0.07 mM	48-h	Liver	None
6929	36355026	2022	HASWEH	LJP-10	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 3.52 ± 0.35 mM	48-h	Liver	None
6927	36355026	2022	FEHSG	LJP-9	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 0.69 ± 0.08 mM	48-h	Liver	None
6925	36355026	2022	FSHTYV	LJP-8	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.76 ± 0.08 mM	48-h	Liver	None
6926	36355026	2022	FEHSG	LJP-9	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 0.53 ± 0.05 mM	48-h	Liver	None
6924	36355026	2022	FSHTYV	LJP-8	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 0.63 ± 0.05 mM	48-h	Liver	None
6923	36355026	2022	FSHTYV	LJP-8	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 0.44 ± 0.04 mM	48-h	Liver	None
6921	36355026	2022	HAGYSWA	LJP-7	7	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 1.66 ± 0.11 mM	48-h	Liver	None
6922	36355026	2022	HAGYSWA	LJP-7	7	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 1.44 ± 0.12 mM	48-h	Liver	None
6920	36355026	2022	HAGYSWA	LJP-7	7	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 2.53 ± 0.24 mM	48-h	Liver	None
6918	36355026	2022	FSTHGG	LJP-5	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 1.49 ± 0.13 mM	48-h	Liver	None
6919	36355026	2022	FKEHGY	LJP-6	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 3.06 ± 0.31 mM	48-h	Liver	None
6917	36355026	2022	FSTHGG	LJP-5	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 2.78 ± 0.26 mM	48-h	Liver	None
6915	36355026	2022	EGHGF	LJP-4	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.68 ± 0.07 mM	48-h	Liver	None
6916	36355026	2022	FSTHGG	LJP-5	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 2.44 ± 0.22 mM	48-h	Liver	None
6914	36355026	2022	EGHGF	LJP-4	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 0.65 ± 0.07 mM	48-h	Liver	None
6912	36355026	2022	FSHRGH	LJP-3	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 1.70 ± 0.15 mM	48-h	Liver	None
6913	36355026	2022	EGHGF	LJP-4	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 0.62 ± 0.07 mM	48-h	Liver	None
6911	36355026	2022	FSHRGH	LJP-3	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 1.42 ± 0.12 mM	48-h	Liver	None
6909	36355026	2022	LWEHSH	LJP-2	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 1.71 ± 0.13 mM	48-h	Liver	None
6910	36355026	2022	LWEHSH	LJP-2	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.62 ± 0.05 mM	48-h	Liver	None
6908	36355026	2022	LWEHSH	LJP-2	6	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 2.25 ± 0.22 mM	48-h	Liver	None
6906	36355026	2022	EGFHL	LJP-1	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 0.45 ± 0.05 mM	48-h	Liver	None
6907	36355026	2022	EGFHL	LJP-1	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	H-22	Liver Cancer	MTT assay	IC₅₀ = 0.36 ± 0.03 mM	48-h	Liver	None
6905	36355026	2022	EGFHL	LJP-1	5	Linear	L	None	Free	Free	Anticancer	Laminaria japonica	Huh-7	Liver Cancer	MTT assay	IC₅₀ = 0.48 ± 0.05 mM	48-h	Liver	None
6904	33916789	2021	FFPLIAGLAARFLPKIFCSITKRC	Brevinin-1RL1	24	Cyclic(C18-C24)	L	None	Free	Free	Antimicrobial	Rana limnocharis	B16-F10	Skin Cancer	MTS assay	IC₅₀ = 6.65 ± 0.33 μM	48-h	Skin	None
6903	33916789	2021	FFPLIAGLAARFLPKIFCSITKRC	Brevinin-1RL1	24	Cyclic(C18-C24)	L	None	Free	Free	Antimicrobial	Rana limnocharis	SMMC-7721	Liver Cancer	MTS assay	IC₅₀ = 6.87 ± 0.51 μM	48-h	Liver	None
6902	33916789	2021	FFPLIAGLAARFLPKIFCSITKRC	Brevinin-1RL1	24	Cyclic(C18-C24)	L	None	Free	Free	Antimicrobial	Rana limnocharis	A-549	Lung Cancer	MTS assay	IC₅₀ = 5.81 ± 0.23 μM	48-h	Lung	None
6901	33916789	2021	FFPLIAGLAARFLPKIFCSITKRC	Brevinin-1RL1	24	Cyclic(C18-C24)	L	None	Free	Free	Antimicrobial	Rana limnocharis	SW-480	Blood Cancer	MTS assay	IC₅₀ = 10.37 ± 0.40 μM	48-h	Blood	None
6900	33916789	2021	FFPLIAGLAARFLPKIFCSITKRC	Brevinin-1RL1	24	Cyclic(C18-C24)	L	None	Free	Free	Antimicrobial	Rana limnocharis	MDA-MB-231	Breast Cancer	MTS assay	IC₅₀ = 5.44 ± 0.33 μM	48-h	Breast	None
6898	34361728	2021	Structure given in figure	GA - 8	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 60.70 ± 0.6 µg/mL	24-h	Colon	None
6899	33916789	2021	FFPLIAGLAARFLPKIFCSITKRC	Brevinin-1RL1	24	Cyclic(C18-C24)	L	None	Free	Free	Antimicrobial	Rana limnocharis	HCT-116	Colon Cancer	MTS assay	IC₅₀ = 5.87 ± 0.15 μM	48-h	Colon	None
6896	34361728	2021	Structure given in figure	GA - 7	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HepG-2	Liver Cancer	MTT assay	IC₅₀ = 3.30 ± 0.1 µg/mL	24-h	Liver	None
6897	34361728	2021	Structure given in figure	GA - 8	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 6.90 ± 1.1 µg/mL	24-h	Breast	None
6894	34361728	2021	Structure given in figure	GA - 7	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 3.70 ± 0.2 µg/mL	24-h	Breast	None
6895	34361728	2021	Structure given in figure	GA - 7	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 3.0 ± 1.1 µg/mL	24-h	Colon	None
6892	34361728	2021	Structure given in figure	GA - 5	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 5.0 ± 0.3 µg/mL	24-h	Breast	None
6893	34361728	2021	Structure given in figure	GA - 5	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 5.2 ± 0.8 µg/mL	24-h	Colon	None
6891	34361728	2021	Structure given in figure	GA - 4	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 73.0 ± 1.4 µg/mL	24-h	Colon	None
6889	34361728	2021	Structure given in figure	GA - 3	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 7.40 ± 0.4 µg/mL	24-h	Colon	None
6890	34361728	2021	Structure given in figure	GA - 4	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 6.10 ± 0.4 µg/mL	24-h	Breast	None
6887	34361728	2021	Structure given in figure	GA - 2	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 70.30 ± 0.9 µg/mL	24-h	Colon	None
6888	34361728	2021	Structure given in figure	GA - 3	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 5.1 ± 0.7 µg/mL	24-h	Breast	None
6886	34361728	2021	Structure given in figure	GA - 2	Not Available	Linear	L	None	Free	18beta-glycyrrhetinic-acid	Antimicrobial and Anticancer	Synthetic (glycyrrhetinic acid (GA)-based peptides)	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 7.70 ± 1.3 µg/mL	24-h	Breast	None
6885	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 1.97 µM	24-h	Cervix	None
6884	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	None	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 18.1 µM	24-h	Cervix	None
6883	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	A-549	Lung Cancer	MTT assay	IC₅₀ = 2.99 µM	24-h	Lung	None
6882	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	None	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	A-549	Lung Cancer	MTT assay	IC₅₀ = 21.6 µM	24-h	Lung	None
6881	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 5.25 µM	24-h	Breast	None
6880	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	None	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 17.5 µM	24-h	Breast	None
6879	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	HT-1080	Fibrosarcoma	MTT assay	IC₅₀ = 5.52 µM	24-h	Not Available	None
6878	34135370	2021	FIHHIFRGIVHAGRSIGRFLTG	Piscidin 3	22	Linear	L	None	Free	Free	Anticancer	Morone chrysops x Morone saxatilis	HT-1080	Fibrosarcoma	MTT assay	IC₅₀ = 26.01 µM	24-h	Not Available	None
6877	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone saxatilis	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 2.17 µM	24-h	Cervix	None
6876	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	None	Free	Free	Anticancer	Morone saxatilis	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 2.22 µM	24-h	Cervix	None
6875	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone saxatilis	A-549	Lung Cancer	MTT assay	IC₅₀ = 2.15 µM	24-h	Lung	None
6874	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	None	Free	Free	Anticancer	Morone saxatilis	A-549	Lung Cancer	MTT assay	IC₅₀ = 4.2 µM	24-h	Lung	None
6873	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone saxatilis	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 3.92 µM	24-h	Breast	None
6872	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	None	Free	Free	Anticancer	Morone saxatilis	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 5.83 µM	24-h	Breast	None
6871	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	Cu2+ bound	Free	Free	Anticancer	Morone saxatilis	HT-1080	Fibrosarcoma	MTT assay	IC₅₀ = 5.31 µM	24-h	Not Available	None
6870	34135370	2021	FFHHIFRGIVHVGKTIHRLVTG	Piscidin 1, Moronecidin	22	Linear	L	None	Free	Free	Anticancer	Morone saxatilis	HT-1080	Fibrosarcoma	MTT assay	IC₅₀ = 5.58 µM	24-h	Not Available	None
6863	33603033	2021	RYGFTEVAGNFQQHNFGRG	L. squarrosulus purifed fraction	19	Linear	L	None	Free	Free	Anticancer	Lentinus squarrosulus (Mont.)	H-460	Lung Cancer	MTT assay	Graph Figure 2	24-h	Lung	None
6862	34789753	2021	GFLDIIKDTGKEFAVKILNNLKCKLAGGCPP	Palustrin - Ca	31	Linear	L	None	Free	Free	Host Defence Peptide	Lithobates catesbeianus	SGC-7901	Gastric Cancer	Not Available	IC₅₀ = 0.951 μg/ml	Not Available	Stomach	None
6861	33677023	2021	GKLRLIKKLWVKKWKKKGWKA	Pep	21	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 2 µM	24-h	Breast	None
6860	33677023	2021	GKLRLIKKLWVKKWKKKGWKA	Pep	21	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 4 µM	24-h	Lung	None
6859	34531430	2021	KKRKKKAFALKFVVDLI	PCC-1	17	Linear	L	None	Amidation	Free	Antimicrobial	Poecilocoris lewisi	G361	Skin Cancer	MTS assay	IC₅₀ = 57.8 µM	48-h	Skin	None
6858	34531430	2021	KKRKKKAFALKFVVDLI	PCC-1	17	Linear	L	None	Amidation	Free	Antimicrobial	Poecilocoris lewisi	SK-Mel-28	Skin Cancer	MTS assay	IC₅₀ = 50.8 µM	48-h	Skin	None
6856	33981363	2021	GBKRLVQRLKDBLRNLV	17BIPHE2	17	Linear	L	None	Free	Free	Antimicrobial	Derivative of LL-37	NCI-H-1975	Lung Cancer	MTT assay	IC₅₀ = 71.42 µmol/L	24-h	Lung	None
6857	33690977	2021	zffygwyggmekllrggrgerppr	NMTP-5	24	Linear	D	Z = C₁₀H₇CH₂C(O), M, 4-(Trifluoromethyl)-D-phenylalanine	Free	Free	Anticancer	Not Available	SK-HEP-1	Liver Cancer	MTT assay	IC₅₀ = 53.84 ± 4.35 µM	48-h	Liver	None
6853	33567789	2021	KnLAKnLAK	Si15	7	Linear	L	nL = nor-Leu	Amidation	Caffeic acid (Caf)	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 140.3 ± 7.12 µM	72-h	Breast	None
6854	33567789	2021	KnLAKnLAK	Si15	7	Linear	L	nL = nor-Leu	Amidation	Caffeic acid (Caf)	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 346.3 ± 7.91 µM	72-h	Breast	None
6855	33981363	2021	GBKRLVQRLKDBLRNLV	17BIPHE2	17	Linear	L	None	Free	Free	Antimicrobial	Derivative of LL-37	A-549	Lung Cancer	MTT assay	IC₅₀ = 34.33 µmol	24-h	Lung	None
6851	33567789	2021	KnLAKnLAK	Si14	7	Linear	L	nL = nor-Leu	Amidation	1,8-naphthalimide-Gly	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 593.3 ± 60.3 µM	72-h	Breast	None
6852	33567789	2021	KnLAKnLAK	Si14	7	Linear	L	nL = nor-Leu	Amidation	1,8-naphthalimide-Gly	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 1049 ± 49.77 µM	72-h	Breast	None
6849	33567789	2021	KL(Beta-A)KL(Beta-A)K	Si11	7	Linear	L	β-Ala	Amidation	Caffeic acid (Caf)	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 1087 ± 70.71 µM	72-h	Breast	None
6850	33567789	2021	KnLAKnLAK	Si13	7	Linear	L	nL = nor-Leu	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 1704 ± 112 µM	72-h	Breast	None
6847	33567789	2021	KL(Beta-A)KL(Beta-A)K	Si2	7	Linear	L	β-Ala	Amidation	1,8-naphthalimide-Gly	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 840 ± 21.18 µM	72-h	Breast	None
6848	33567789	2021	KL(Beta-A)KLAK	Si11	7	Linear	L	β-Ala	Amidation	Caffeic acid (Caf)	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 228.8 ± 7.18 µM	72-h	Breast	None
6846	33567789	2021	KL(Beta-A)KL(Beta-A)K	Si2	7	Linear	L	β-Ala	Amidation	1,8-naphthalimide-Gly	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 662.9 ± 20.02 µM	72-h	Breast	None
6844	33567789	2021	KLAKLAK	Si8	7	Linear	L	None	Amidation	Caffeic acid (Caf)	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 514.3 ± 26.82 µM	72-h	Breast	None
6845	33567789	2021	KL(Beta-A)KL(Beta-A)AK	Si3	8	Linear	L	β-Ala	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 176.3 ± 4.66 µM	72-h	Breast	None
6842	33567789	2021	KLAKLAK	Si7	7	Linear	L	None	Amidation	1,8-naphthalimide-Gly	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 1195 ± 131.5 µM	72-h	Breast	None
6843	33567789	2021	KLAKLAK	Si8	7	Linear	L	None	Amidation	Caffeic acid (Caf)	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 128.6 ± 8.03 µM	72-h	Breast	None
6841	33567789	2021	(KLAKLAK)₂	Si1	14	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 746.5 ± 7.6 µM	72-h	Breast	None
6840	33567789	2021	(KLAKLAK)₂	Si1	14	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 124.1 ± 8.12 µM	72-h	Breast	None
6839	33428507	2021	LHHLLHLLHHLLHL	L8H6	14	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 16.4 µM	24-h	Cervix	None
6838	33428507	2021	LHLLLHLLHHLLHL	L9H5-1	14	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 5.4 µM	24-h	Cervix	None
6837	None	2021	FPLPCAYKGTYC	SKACP003	12	Linear	L	None	Free	Free	Anticancer	Synthetic	MDA-MB-453	Breast Cancer	MTT assay	IC₅₀ = 156 ± 0.5 µM	24-h	Breast	None
6836	None	2021	FPLPCAYKGTYC	SKACP003	12	Linear	L	None	Free	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 212 ± 0.5 µM	24-h	Breast	None
6835	None	2021	FPLPCAYKGTYC	SKACP003	12	Linear	L	None	Free	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 193 ± 0.5 µM	24-h	Breast	None
6834	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	HT-29	Colon Cancer	MTT assay	Not Available	Not Available	Colon	None
6833	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	RKO	Colon Cancer	MTT assay	25% cell viability at at 20 μM	24-h	Colon	None
6832	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	HCT-15	Colon Cancer	MTT assay	Not Available	Not Available	Colon	None
6831	32381104	2021	YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM	Sur-X	35	Linear	L	None	Free	TAT Peptide	Anticancer	Synthetic	HCT-116	Colon Cancer	MTT assay	20% cell viability at at 20 μM	24-h	Colon	None
6830	34440185	2021	SFIPRAKSTWLNNIKLL	HMP-S7	17	Linear	L	None	Free	Free	Anticancer	Human Milk	Sup-B15	Blood Cancer	Trypan blue assay	IC₅₀ = 90 ± 14 µM	24-h	Blood	None
6828	34440185	2021	SFIPRAKSTWLNNIKLL	HMP-S7	17	Linear	L	None	Free	Free	Anticancer	Human Milk	RS4;11	Blood Cancer	Trypan blue assay	IC₅₀ = 184 ± 23 µM	24-h	Blood	None
6829	34440185	2021	SFIPRAKSTWLNNIKLL	HMP-S7	17	Linear	L	None	Free	Free	Anticancer	Human Milk	Raji	Lymphoma Cancer	Trypan blue assay	IC₅₀ = 89 ± 24 µM	24-h	Blood	None
6827	34440185	2021	SFIPRAKSTWLNNIKLL	HMP-S7	17	Linear	L	None	Free	Free	Anticancer	Human Milk	Jurkat	Blood Cancer	Trypan blue assay	IC₅₀ = 186 ± 37 µM	24-h	Blood	None
6826	33442881	2021	FLGALWNVAKRVF	[Arg]¹¹-VmCT1	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 25.8 ± 5.2 μmol/L	24-h	Breast	None
6825	33442881	2021	FLGALWRVAKSVF	[Arg]⁷-VmCT1	13	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 18.0 ± 2.7 μmol/L	24-h	Breast	None
6824	33442881	2021	FLRALWNVAKSVF	[Arg]³-VmCT1	13	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 20.6 ± 3.1 μmol/L	24-h	Breast	None
6823	33442881	2021	FLGALWNVAKSVF	VmCT1	13	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Vaejovis mexicanus smithi	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 8.3 ± 1.4 μmol/L	24-h	Breast	None
6821	34941705	2021	ASIGALIQKAIALIKAKAA	LVTX-9-C18	19	Linear	L	None	Amidation	CH₃-(CH₂)₁₆-CO	Anticancer	Synthetic	HepG-2	Liver Cancer	CCK-8 assay	IC₅₀ = 7.0 ± 1.0 µM	24-h	Liver	None
6822	34941705	2021	ASIGALIQKAIALIKAKAA	LVTX-9-C18	19	Linear	L	None	Amidation	CH₃-(CH₂)₁₆-CO	Anticancer	Synthetic	HeLa	Cervical Cancer	CCK-8 assay	IC₅₀ = 4.7 ± 1.4 µM	24-h	Cervix	None
6819	34941705	2021	ASIGALIQKAIALIKAKAA	LVTX-9-C18	19	Linear	L	None	Amidation	CH₃-(CH₂)₁₆-CO	Anticancer	Synthetic	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 6.2 ± 1.4 µM	24-h	Lung	None
6820	34941705	2021	ASIGALIQKAIALIKAKAA	LVTX-9-C18	19	Linear	L	None	Amidation	CH₃-(CH₂)₁₆-CO	Anticancer	Synthetic	4T1	Breast Cancer	CCK-8 assay	IC₅₀ = 7.6 ± 1.3 µM	24-h	Breast	None
6818	34941705	2021	ASIGALIQKAIALIKAKAA	LVTX-9	19	Linear	L	None	Amidation	Free	Anticancer	Lycosa vittata	A-549	Lung Cancer	CCK-8 assay	IC₅₀ = 51.7 ± 4.3 µM	24-h	Lung	None
6817	33244888	2021	IFGTILGFLKGL	Protonectin-F	12	Linear	L	None	Amidation	Free	Antimicrobial	Protonoectin	HCT-116	Colon Cancer	Resazurin dye assay	CC₅₀ = 9.8 ± 1.2 µM	24-h	Colon	None
6816	33244888	2021	IFGTILGFLKGL	Protonectin-F	12	Linear	L	None	Amidation	Free	Antimicrobial	Protonoectin	MM96L	Skin Cancer	Resazurin dye assay	CC₅₀ = 16.0 ± 1.2 µM	24-h	Skin	None
6815	33244888	2021	ILGTILGLLKGL	Protonectin	12	Linear	L	None	Amidation	Free	Antimicrobial	Parachartergus fraternus	HCT-116	Colon Cancer	Resazurin dye assay	CC₅₀ = 8.0 ± 0.5 µM	24-h	Colon	None
6814	33244888	2021	ILGTILGLLKGL	Protonectin	12	Linear	L	None	Amidation	Free	Antimicrobial	Parachartergus fraternus	MM96L	Skin Cancer	Resazurin dye assay	CC₅₀ = 14.8 ± 0.9 µM	24-h	Skin	None
6813	34309373	2021	FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ	Pal-pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid; pFL - a hydrophobic peptide fragment (FPWWWPFL) rich in tryptophan (W)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 11.85 μM	24-h	Breast	None
6812	34309373	2021	FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ	Pal-pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid; pFL - a hydrophobic peptide fragment (FPWWWPFL) rich in tryptophan (W)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-549	Lung Cancer	MTT assay	IC₅₀ = 31.17 μM	24-h	Lung	None
6811	34309373	2021	FPWWWPFLRDVFTKGYGFGLGRKKRRQRRRPQ	Pal-pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid; pFL - a hydrophobic peptide fragment (FPWWWPFL) rich in tryptophan (W)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-375	Skin Cancer	MTT assay	IC₅₀ = 5.5 ± 1.1 μM	24-h	Skin	None
6810	34309373	2021	FPWWWPFL-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ	pFL-N-Ter-TAT	32	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	pFL = hydrophobic peptide fragment (FPWWWPFL)	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-375	Skin Cancer	MTT assay	IC₅₀ = 11.1 ± 0.1 μM	24-h	Skin	None
6809	34309373	2021	Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ	Pal-N-Ter-TAT	24	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 27.26 μM	24-h	Breast	None
6808	34309373	2021	Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ	Pal-N-Ter-TAT	24	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-549	Lung Cancer	MTT assay	IC₅₀ = 44.98 μM	24-h	Lung	None
6807	34309373	2021	Pal-RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ	Pal-N-Ter-TAT	24	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Palmitic acid	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-375	Skin Cancer	MTT assay	IC₅₀ = 36.67(Supplementary material)/15.2 ± 0.7 μM(Published paper)	24-h	Skin	None
6806	34309373	2021	RDVFTKGYGFGL	N-Ter	12	Linear	L	None	Free	Free	Anticancer	Analogue of N-terminal fragment of the VDAC1 protein	A-375	Skin Cancer	MTT assay	IC₅₀(A-375)> 50.0 μM	24-h	Skin	None
6803	34117917	2021	FKKLKKLFSKLWNWK	HPRP-A1	15	Linear	L	None	Amidation	Acetylation	Anticancer	N-terminal region of Helicobacter pylori ribosomal protein L1	HT-29	Colon Cancer	MTT assay	IC₅₀ ~ 0.5 µg/mL	24-h	Colon	None
6802	34117917	2021	FKKLKKLFSKLWNWK	HPRP-A1	15	Linear	L	None	Amidation	Acetylation	Anticancer	N-terminal region of Helicobacter pylori ribosomal protein L1	CT-26	Colorectal Cancer	MTT assay	IC₅₀ between 0.5 and 1 µg/mL	24-h	Colon	None
6801	34848729	2021	TGIATSGLATFTLHTGSLAPAT	AtMP2	22	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Anabastestudineus skin mucus fraction 2	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 6.97 ± 0.24 μg/ml	48-h	Breast	None
6800	34848729	2021	TGIATSGLATFTLHTGSLAPAT	AtMP2	22	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Anabastestudineus skin mucus fraction 2	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 5.89 ± 0.14 μg/ml	48-h	Breast	None
6799	34848729	2021	THPPTTTTTTTTTTTTTAAPATTT	AtMP1	24	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Anabastestudineus skin mucus fraction 2	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 9.35 ± 0.25 μg/ml	48-h	Breast	None
6798	34848729	2021	THPPTTTTTTTTTTTTTAAPATTT	AtMP1	24	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Anabastestudineus skin mucus fraction 2	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 8.25 ± 0.14 μg/ml	48-h	Breast	None
6797	33517264	2021	ICIFCCGCCHRSKCGMCCKT	Hepcidin	20	Linear	L	None	Free	Free	Antimicrobial and Anticancer	Homo sapiens	U-266	Lymphoma Cancer	MTT assay	NA	NA	Blood	None
6796	34796903	2021	FLGWLFKVASK	A4W-GGN5	11	Linear	L	None	Amidation	Free	Anticancer	Gaegurin 5	SW-620	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 22.07 ± 1.63 µM	48-h	Colon	None
6795	34796903	2021	FLGWLFKVASK	A4W-GGN5	11	Linear	L	None	Amidation	Free	Anticancer	Gaegurin 5	SW-480	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 98.63 ± 1.17 µM	48-h	Colon	None
6793	34796903	2021	TYFNAVKPPITA	Loop2-PS2Aa	12	Linear	L	None	Amidation	Free	Anticancer	Parasporin-2Aa1	SW-620	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 15.95 ± 0.69 µM	48-h	Colon	None
6794	34796903	2021	FKPQSGGGKCF	Loop1-HCoV-229E	11	Linear	L	None	Amidation	Free	Anticancer	Alphacoronavirus (HCoV-229E)	SW-480	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 125.0 ± 1.32 µM	48-h	Colon	None
6792	34796903	2021	TYFNAVKPPITA	Loop2-PS2Aa	12	Linear	L	None	Amidation	Free	Anticancer	Parasporin-2Aa1	SW-480	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 92.99 ± 0.98 µM	48-h	Colon	None
6791	34796903	2021	NNETYFNAVKP	Loop1-PS2Aa	11	Linear	L	None	Amidation	Free	Anticancer	Parasporin-2Aa1	SW-620	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 106.2 ± 1.67 µM	48-h	Colon	None
6790	34796903	2021	NNETYFNAVKP	Loop1-PS2Aa	11	Linear	L	None	Amidation	Free	Anticancer	Parasporin-2Aa1	SW-480	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 23.76 ± 1.25 µM	48-h	Colon	None
6789	34796903	2021	PARDVLNTTSG	P264-G274	11	Linear	L	None	Amidation	Free	Anticancer	Parasporin-2Aa1	SW-620	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 11.28 ± 0.52 µM	48-h	Colon	None
6788	34796903	2021	PARDVLNTTSG	P264-G274	11	Linear	L	None	Amidation	Free	Anticancer	Parasporin-2Aa1	SW-480	Colorectal Cancer	Sulforhodamine B assay	EC₅₀ = 90.98 ± 0.75 µM	48-h	Colon	None
6787	33245189	2021	KWCFRVCYRGICYIRRCR	Tachyplesin	17	Linear	L	None	Amidation	Free	Antibacterial	Horseshoe crab	H-460	Lung Cancer	MTT assay	IC₅₀ = 25 µg/ml	24-h	Lung	None
6786	33245189	2021	KWCFRVCYRGICYIRRCR	Tachyplesin	17	Linear	L	None	Amidation	Free	Antibacterial	Horseshoe crab	A-549	Lung Cancer	MTT assay	IC₅₀ = 35 µg/ml	24-h	Lung	None
6785	33562681	2021	FIHHIIGGLFSAGKAIHRLIRRRRR	TP4	25	Linear	L	None	Free	Free	Antimicrobial	Oreochromis niloticus	Aska-SS	Synovial Sarcoma	MTS assay	IC₅₀ = 32.41 μg/mL	NA	Muscle	None
6784	33562681	2021	FIHHIIGGLFSAGKAIHRLIRRRRR	TP4	25	Linear	L	None	Free	Free	Antimicrobial	Oreochromis niloticus	SW982	Synovial Sarcoma	MTS assay	IC₅₀ = 29.20 μg/mL	NA	Muscle	None
6783	34449322	2021	PMPVSQECFETLRGHERILSILRHQNLLKELQDLALQGAKERAHQQ	rhCGA-N46	46	Linear	L	None	Free	Free	Antimicrobial	Found in neurons and endocrine cells in Humans	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 1.997 µg/ml	24-h	Colon	None
6782	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	LoVo	Colon Cancer	MTT assay	IC₅₀ = 128 µM	24-h	Colon	None
6781	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	HeLa	Cervical Cancer	MTT assay	IC₅₀ > 128 µM	24-h	Cervix	None
6780	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	MCF-7	Breast Cancer	MTT assay	IC₅₀ > 128 µM	24-h	Breast	None
6779	34073203	2021	GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP	Ranatuerin-2	31	Linear	L	None	Free	Free	Anticancer	Rana catesbeiana	A-549	Lung Cancer	MTT assay	IC₅₀ > 128 µM	24-h	Lung	None
6778	34461456	2021	gigavlkvlttglpaliswikrkrqqc	D-melittin	27	Linear	D	None	Free	Free	Anticancer	Synthetic	MDA-MB-435 DOX-R	Breast Cancer	MTS assay	IC₅₀ = 3.4 µM	24-h	Breast	None
6777	34461456	2021	gigavlkvlttglpaliswikrkrqqc	D-melittin	27	Linear	D	None	Free	Free	Anticancer	Synthetic	MDA-MB-435 WT	Breast Cancer	MTS assay	IC₅₀ = 3.5 µM	24-h	Breast	None
6776	34461456	2021	gigavlkvlttglpaliswikrkrqqc	D-melittin	27	Linear	D	None	Free	Free	Anticancer	Synthetic	CT-26	Colorectal Cancer	MTS assay	IC₅₀ = 2.2 µM	24-h	Colon	None
6775	34461456	2021	gigavlkvlttglpaliswikrkrqqc	D-melittin	27	Linear	D	None	Free	Free	Anticancer	Synthetic	A-549	Lung Cancer	MTS assay	IC₅₀ = 4.5 µM	24-h	Lung	None
6774	33462944	2021	FSHTYV	GP-3	6	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	Colo-320	Colon Cancer	MTT assay	IC₅₀ = 149 ± 15.2 µM	48-h	Colon	None
6772	33462944	2021	FSHTYV	GP-3	6	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	CT-26	Colorectal Cancer	MTT assay	IC₅₀ = 133 ± 12.5 µM	48-h	Colon	None
6773	33462944	2021	FSHTYV	GP-3	6	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 162 ± 17.1 µM	48-h	Colon	None
6770	33462944	2021	EGFHL	GP-2	5	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 154 ± 15.8 µM	48-h	Colon	None
6771	33462944	2021	EGFHL	GP-2	5	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	Colo-320	Colon Cancer	MTT assay	IC₅₀ = 142 ± 14.9 µM	48-h	Colon	None
6768	33462944	2021	FKEHGY	GP-1	6	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	Colo-320	Colon Cancer	MTT assay	IC₅₀ = 111 ± 12.0 µM	48-h	Colon	None
6769	33462944	2021	EGFHL	GP-2	5	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	CT-26	Colorectal Cancer	MTT assay	IC₅₀ = 114 ± 12.1 µM	48-h	Colon	None
6767	33462944	2021	FKEHGY	GP-1	6	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 104 ± 11.3 µM	48-h	Colon	None
6766	33462944	2021	FKEHGY	GP-1	6	Linear	L	None	Amidation	Free	Anticancer	Ginseng Leaf Peptide	CT-26	Colorectal Cancer	MTT assay	IC₅₀ = 86.4 ± 9.46 µM	48-h	Colon	None
6765	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	LoVo	Colon Cancer	MTT assay	IC₅₀ = 35.05 µM	24-h	Colon	None
6764	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 23.26 µM	24-h	Cervix	None
6763	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 37.84 µM	24-h	Breast	None
6762	34073203	2021	GLFDVVKGVLKGAGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYb	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	A-549	Lung Cancer	MTT assay	IC₅₀ = 24.01 µM	24-h	Lung	None
6761	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	LoVo	Colon Cancer	MTT assay	IC₅₀ = 55.22 µM	24-h	Colon	None
6760	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 52.83 µM	24-h	Cervix	None
6759	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 41.21 µM	24-h	Breast	None
6758	34073203	2021	GVLGAVKDLLIGAGKSAAQSVLKTLSCKLSNDC	Odorranain-C1	33	Linear	L	None	Free	Free	Anticancer	Odorrana grahami	A-549	Lung Cancer	MTT assay	IC₅₀ = 27.31 µM	24-h	Lung	None
6757	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	LoVo	Colon Cancer	MTT assay	IC₅₀ = 59.78 µM	24-h	Colon	None
6755	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 45.25 µM	24-h	Breast	None
6756	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 37.23 µM	24-h	Cervix	None
6754	34073203	2021	GILSSIKGVAKGVAKNVAAQLLDTLKCKITGC	Ranatuerin-2Lb	32	Linear	L	None	Free	Free	Anticancer	Rana luteiventris	A-549	Lung Cancer	MTT assay	IC₅₀ = 15.32 µM	24-h	Lung	None
6753	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	LoVo	Colon Cancer	MTT assay	IC₅₀ = 8.05 µg/ml	24-h	Colon	None
6752	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	HeLa	Cervical Cancer	MTT assay	IC₅₀ = 19.69 µg/ml	24-h	Cervix	None
6751	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 25.74 µg/ml	24-h	Breast	None
6750	34073203	2021	GIFDVVKGVLKGVGKNVAGSLLEQLKCKLSGGC	Brevinin-2DYd	33	Linear	L	None	Free	Free	Anticancer	Rana dybowskii	A-549	Lung Cancer	MTT assay	IC₅₀ = 2.975 µg/ml	24-h	Lung	None
6749	33919639	2021	RMMRIFWVIKLAR	Pugnin B	13	Linear	L	None	Free	Free	Antibacterial and Anticancer	Synthetic; Using Skin Transcriptome of Treefrog ( Boana pugnax)	PC-3	Prostate Cancer	MTT assay	90% Cytotoxicity at 100 µM	24-h	Prostate	None
6748	33919639	2021	RMMRIFWVIKLAR	Pugnin B	13	Linear	L	None	Free	Free	Antibacterial and Anticancer	Synthetic; Using Skin Transcriptome of Treefrog ( Boana pugnax)	MCF-7	Breast Cancer	MTT assay	5% Cytotoxicity at 100 µM	24-h	Breast	None
6747	33919639	2021	RLMRIFRILKLAR	Pugnin A	13	Linear	L	None	Free	Free	Antibacterial and Anticancer	Synthetic; Using Skin Transcriptome of Treefrog ( Boana pugnax)	PC-3	Prostate Cancer	MTT assay	74% Cytotoxicity at 100 µM	24-h	Prostate	None
6745	34935253	2021	WHLV	LCP-3	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 68.2 ± 7.11 μM	48-h	Colon	None
6746	33919639	2021	RLMRIFRILKLAR	Pugnin A	13	Linear	L	None	Free	Free	Antibacterial and Anticancer	Synthetic; Using Skin Transcriptome of Treefrog ( Boana pugnax)	MCF-7	Breast Cancer	MTT assay	12% Cytotoxicity at 100 µM	24-h	Breast	None
6743	34935253	2021	WHLV	LCP-3	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	MKN-45	Gastric Cancer	MTT assay	IC₅₀ = 86.9 ± 9.11 μM	48-h	Stomach	None
6744	34935253	2021	WHLV	LCP-3	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	HepG-2	Gastric Cancer	MTT assay	IC₅₀ = 85.2 ± 9.27 μM	48-h	Stomach	None
6740	34935253	2021	WAHT	LCP-2	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	HepG-2	Gastric Cancer	MTT assay	IC₅₀ = 96.9 ± 9.91 μM	48-h	Stomach	None
6741	34935253	2021	WAHT	LCP-2	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 100 ± 11.6 μM	48-h	Colon	None
6742	34935253	2021	WHLV	LCP-3	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	SGC-7901	Gastric Cancer	MTT assay	IC₅₀ = 101 ± 10.6 μM	48-h	Stomach	None
6738	34935253	2021	WAHT	LCP-2	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	SGC-7901	Gastric Cancer	MTT assay	IC₅₀ = 116 ± 12.4 μM	48-h	Stomach	None
6739	34935253	2021	WAHT	LCP-2	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	MKN-45	Gastric Cancer	MTT assay	IC₅₀ = 107 ± 11.8 μM	48-h	Stomach	None
6735	34935253	2021	FHVL	LCP-1	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	MKN-45	Gastric Cancer	MTT assay	IC₅₀ = 128 ± 13.5 μM	48-h	Stomach	None
6736	34935253	2021	FHVL	LCP-1	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	HepG-2	Gastric Cancer	MTT assay	IC₅₀ = 123 ± 12.9 μM	48-h	Stomach	None
6737	34935253	2021	FHVL	LCP-1	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	CaCo-2	Colon Cancer	MTT assay	IC₅₀ = 131 ± 13.4 μM	48-h	Colon	None
6733	33757145	2021	RALGWSCL	P2	8	Linear	L	None	Free	Free	Anticancer	Zingiber officinale	Raji	Lymphoma Cancer	MTT assay	IC₅₀ = 700 μg/mL	24-h	Blood	None
6734	34935253	2021	FHVL	LCP-1	4	Cyclic	L	None	Cyclized	Cyclized	Anticancer	Laminaria japonica	SGC-7901	Gastric Cancer	MTT assay	IC₅₀ = 111 ± 10.6 μM	48-h	Stomach	None
6732	33757145	2021	RALGWSCL	P2	8	Linear	L	None	Free	Free	Anticancer	Zingiber officinale	MOLT-4	Luekemia Cancer	MTT assay	IC₅₀ = 700 μg/mL	24-h	Blood	None
6730	34309373	2021	RDVFTKGYGFGL-GRK(Dansylglycine)KRRQRRRPQ	N-Ter-TAT	24	Linear	L	Dansylglycine = fluorescent amino acid residue located in the side chain of lysine	TAT	Free	Anticancer	Synthetic	A-375	Skin Cancer	MTT assay	IC₅₀ > 50.0 μM	24-h	Skin	None
6731	33757145	2021	RALGWSCL	P2	8	Linear	L	None	Free	Free	Anticancer	Zingiber officinale	NB-4	Luekemia Cancer	MTT assay	IC₅₀ = 600 μg/mL	24-h	Blood	None
6729	34394384	2021	SLSLSVAR	MIPP	8	Linear	L	None	Free	Free	Anticancer	Morchella importuna	HeLa	Cervical Cancer	MTT assay	Inhibitory rate = 59.36 ± 3.67% at 400 μg/mL	24-h	Cervix	None
6728	33582221	2021	ALWKDLLKNVGIAAGKAALNKVTDMVNQ	Dermaseptin-TO	28	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa tomopterna	PC-3	Prostate Cancer	MTT assay	Graph Figure-7	24-h	Prostate	None
6727	33582221	2021	ALWKDLLKNVGIAAGKAALNKVTDMVNQ	Dermaseptin-TO	28	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa tomopterna	H-157	Lung Cancer	MTT assay	Graph Figure-7	24-h	Lung	None
6726	33582221	2021	ALWKDLLKNVGIAAGKAALNKVTDMVNQ	Dermaseptin-TO	28	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa tomopterna	U251-MG	Brain Tumor	MTT assay	Graph Figure-7	24-h	Brain	None
6725	34572719	2021	IWLTALKFLGKNLGKLAKQQLAKL	LyeTxI-b	24	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 5.77 ± 0.83 µM	48-h	Breast	None
6724	34572719	2021	IWLTALKFLGKNLGKLAKQQLAKL	LyeTxI-b	24	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 7.34 ± 3.09 µM	48-h	Breast	None
6723	34572719	2021	IWLTALKFLGKNLGKLAKQQLAKL	LyeTxI-b	24	Linear	L	None	Amidation	Free	Antimicrobial and Anticancer	Synthetic	4T1	Breast Cancer	MTT assay	IC₅₀ = 6.5 ± 5.30 µM	48-h	Breast	None
6722	34236134	2021	FKCRRWQWRMKKLGAPSITCVRRAF	Bovine Lactoferricin (LfcinB)	25	Linear	L	None	Free	Free	Antimicrobial	Bovine Milk	MDA-MB-231	Breast Cancer	Annexin V-FITC assay	~80% cell death at 200 µg/ml	48-h	Breast	None
6721	34236134	2021	FKCRRWQWRMKKLGAPSITCVRRAF	Bovine Lactoferricin (LfcinB)	25	Linear	L	None	Free	Free	Antimicrobial	Bovine Milk	MCF-7	Breast Cancer	Annexin V-FITC assay	~50% cell death at 300 µg/ml	48-h	Breast	None
6720	34236134	2021	FKCRRWQWRMKKLGAPSITCVRRAF	Bovine Lactoferricin (LfcinB)	25	Linear	L	None	Free	Free	Antimicrobial	Bovine Milk	SK-BR-3	Breast Cancer	Annexin V-FITC assay	~80% cell death at 100 µg/ml	48-h	Breast	None
6719	34236134	2021	FKCRRWQWRMKKLGAPSITCVRRAF	Bovine Lactoferricin (LfcinB)	25	Linear	L	None	Free	Free	Antimicrobial	Bovine Milk	MDA-MB-468	Breast Cancer	Annexin V-FITC assay	~60% cell death at 300 µg/ml	48-h	Breast	None
6718	34564615	2021	FlPLIASLAGNVVPKIFCKITKRC	B1OS-D-L	24	Linear	Mix	None	Free	Free	Antimicrobial	B-1OS	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 3.721 µM	24-h	Colon	None
6717	34564615	2021	FlPLIASLAGNVVPKIFCKITKRC	B1OS-D-L	24	Linear	Mix	None	Free	Free	Antimicrobial	B-1OS	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 3.17 µM	24-h	Breast	None
6716	34564615	2021	FlPLIASLAGNVVPKIFCKITKRC	B1OS-D-L	24	Linear	Mix	None	Free	Free	Antimicrobial	B-1OS	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 3.492 µM	24-h	Brain	None
6715	34564615	2021	FlPLIASLAGNVVPKIFCKITKRC	B1OS-D-L	24	Linear	Mix	None	Free	Free	Antimicrobial	B-1OS	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 2.629 µM	24-h	Prostate	None
6714	34564615	2021	FlPLIASLAGNVVPKIFCKITKRC	B1OS-D-L	24	Linear	Mix	None	Free	Free	Antimicrobial	B-1OS	H-838	Lung Cancer	MTT assay	IC₅₀ = 2.553 µM	24-h	Lung	None
6713	34564615	2021	FLPLIASLAGNVVPKIFCKITKRC	B1OS-L	24	Linear	L	None	Free	Free	Antimicrobial	B-1OS	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 11.03 µM	24-h	Colon	None
6712	34564615	2021	FLPLIASLAGNVVPKIFCKITKRC	B1OS-L	24	Linear	L	None	Free	Free	Antimicrobial	B-1OS	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 8.883 µM	24-h	Breast	None
6711	34564615	2021	FLPLIASLAGNVVPKIFCKITKRC	B1OS-L	24	Linear	L	None	Free	Free	Antimicrobial	B-1OS	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 8.629 µM	24-h	Brain	None
6710	34564615	2021	FLPLIASLAGNVVPKIFCKITKRC	B1OS-L	24	Linear	L	None	Free	Free	Antimicrobial	B-1OS	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 5.473 µM	24-h	Prostate	None
6709	34564615	2021	FLPLIASLAGNVVPKIFCKITKRC	B1OS-L	24	Linear	L	None	Free	Free	Antimicrobial	B-1OS	H-838	Lung Cancer	MTT assay	IC₅₀ = 3.976 µM	24-h	Lung	None
6708	34564615	2021	FPLIASLAGNVVPKIFCKITKRC	B1OS	23	Linear	L	None	Free	Free	Antimicrobial	Odorrana schmackeri	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 33.69 µM	24-h	Colon	None
6707	34564615	2021	FPLIASLAGNVVPKIFCKITKRC	B1OS	23	Linear	L	None	Free	Free	Antimicrobial	Odorrana schmackeri	MCF-7	Breast Cancer	MTT assay	IC₅₀ = 112 µM	24-h	Breast	None
6706	34564615	2021	FPLIASLAGNVVPKIFCKITKRC	B1OS	23	Linear	L	None	Free	Free	Antimicrobial	Odorrana schmackeri	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 233.0 µM	24-h	Brain	None
6705	34564615	2021	FPLIASLAGNVVPKIFCKITKRC	B1OS	23	Linear	L	None	Free	Free	Antimicrobial	Odorrana schmackeri	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 95.94 µM	24-h	Prostate	None
6704	34564615	2021	FPLIASLAGNVVPKIFCKITKRC	B1OS	23	Linear	L	None	Free	Free	Antimicrobial	Odorrana schmackeri	H-838	Lung Cancer	MTT assay	IC₅₀ = 36.84 µM	24-h	Lung	None
6703	32812694	2021	FALGAVTKVLYKLFCLITRKC	Brevinin-1HY	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 3.583 µM	24-h	Colon	None
6702	32812694	2021	FALGAVTKVLYKLFCLITRKC	Brevinin-1HY	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	H-157	Lung Cancer	MTT assay	IC₅₀ = 2.811 µM	24-h	Lung	None
6701	32812694	2021	FALGAVTKVLYKLFCLITRKC	Brevinin-1HY	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	MDA-MB-435S	Breast Cancer	MTT assay	IC₅₀ = 2.243 µM	24-h	Breast	None
6700	32812694	2021	FALGAVTKVLYKLFCLITRKC	Brevinin-1HY	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 5.425 µM	24-h	Prostate	None
6699	32812694	2021	FALGAVTCLIRTKCKVLPKLF	Brevinin-1Ha	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 342.8 µM	24-h	Colon	None
6698	32812694	2021	FALGAVTCLIRTKCKVLPKLF	Brevinin-1Ha	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	H-157	Lung Cancer	MTT assay	IC₅₀ = 278.9 µM	24-h	Lung	None
6697	32812694	2021	FALGAVTCLIRTKCKVLPKLF	Brevinin-1Ha	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	MDA-MB-435S	Breast Cancer	MTT assay	IC₅₀ = 214.7 µM	24-h	Breast	None
6696	32812694	2021	FALGAVTCLIRTKCKVLPKLF	Brevinin-1Ha	21	Linear	L	None	Free	Free	Antimicrobial	Analogue of Brevinin-1H	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 186.9 µM	24-h	Prostate	None
6695	32812694	2021	FALGAVTKVLPKLFCLITRKC	Brevinin-1H	21	Linear	L	None	Free	Free	Antimicrobial	Amolops hainanensis	HCT-116	Colon Cancer	MTT assay	IC₅₀ = 2.599 µM	24-h	Colon	None
6694	32812694	2021	FALGAVTKVLPKLFCLITRKC	Brevinin-1H	21	Linear	L	None	Free	Free	Antimicrobial	Amolops hainanensis	H-157	Lung Cancer	MTT assay	IC₅₀ = 3.37 µM	24-h	Lung	None
6693	32812694	2021	FALGAVTKVLPKLFCLITRKC	Brevinin-1H	21	Linear	L	None	Free	Free	Antimicrobial	Amolops hainanensis	MDA-MB-435S	Breast Cancer	MTT assay	IC₅₀ = 3.47 µM	24-h	Breast	None
6692	32812694	2021	FALGAVTKVLPKLFCLITRKC	Brevinin-1H	21	Linear	L	None	Free	Free	Antimicrobial	Amolops hainanensis	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 5.87 µM	24-h	Prostate	None
6691	33489681	2021	ADLPGLK	Chickpea	7	Linear	L	None	Free	Free	Anticancer	Cicer arietinum L.	MCF-7	Breast Cancer	Sulforhodamine B assay	IC₅₀ = 110.3 ± 2.97µM	NA	Breast	None
6690	33489681	2021	ADLPGLK	Chickpea	7	Linear	L	None	Free	Free	Anticancer	Cicer arietinum L.	MDA-MB-231	Breast Cancer	Sulforhodamine B assay	IC₅₀ = 107.2 ± 1.62µM	NA	Breast	None
6688	33489681	2021	ADLPGLK	Chickpea	7	Linear	L	None	Free	Free	Anticancer	Cicer arietinum L.	A-549	Lung Cancer	Sulforhodamine B assay	IC₅₀ = 126.4 ± 1.98 µM	NA	Lung	None
6689	33489681	2021	ADLPGLK	Chickpea	7	Linear	L	None	Free	Free	Anticancer	Cicer arietinum L.	HepG-2	Liver Cancer	Sulforhodamine B assay	IC₅₀ = 113.7 ± 0.99 µM	NA	Liver	None
6687	33489681	2021	ADLPGLK	Chickpea	7	Linear	L	None	Free	Free	Anticancer	Cicer arietinum L.	Ishikawa	Endometrial Cancer	Sulforhodamine B assay	IC₅₀ = 101.5 ± 1.83 µM	NA	Endometrium	None
6686	33489681	2021	ADLPGLK	Chickpea	7	Linear	L	None	Free	Free	Anticancer	Cicer arietinum L.	PA-1	Ovarian Cancer	Sulforhodamine B assay	IC₅₀ = 133.4 ± 0.70µM	NA	Ovary	None
6685	33595876	2021	VKLRSLLCS	VS-9	9	Linear	L	None	Free	Free	Anticancer	Allium sativum	K-562	Blood Cancer	MTT assay	IC₅₀ = 1.57 mM	48-h	Blood	None
6684	33595876	2021	VKLRSLLCS	VS-9	9	Linear	L	None	Free	Free	Anticancer	Allium sativum	MOLT-4	Blood Cancer	MTT assay	IC₅₀ = 0.84 mM	48-h	Blood	None
6681	34867962	2021	FLPLLISALTSLFPKLGK	SSTP1	18	Linear	L	None	Free	Free	Host Defense Peptide	Indosylvirana aurantiaca	HSC-4	Tongue Squamous Cell Carcinoma	MTT assay	IC₅₀ = 10.22 μM	48-h	Tongue	None
6680	34867962	2021	FLPLLISALTSLFPKLGK	SSTP1	18	Linear	L	None	Free	Free	Host Defense Peptide	Indosylvirana aurantiaca	MDA-MB-231	Breast Cancer	MTT assay	IC₅₀ = 4.5 μM	48-h	Breast	None
6679	34943741	2021	WLWKKIKNVAKAAGKAAKGAL	t-DPH1-6KW	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 1499 μM	24-h	Brain	None
6678	34943741	2021	WLWKKIKNVAKAAGKAAKGAL	t-DPH1-6KW	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-157	Lung Cancer	MTT assay	IC₅₀ = 427.3 μM	24-h	Lung	None
6677	34943741	2021	WLWKKIKNVAKAAGKAAKGAL	t-DPH1-6KW	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-838	Lung Cancer	MTT assay	IC₅₀ = 180.8 μM	24-h	Lung	None
6676	34943741	2021	WLWKKIKNVAKAAGKAAKGAL	t-DPH1-6KW	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 118.4 μM	24-h	Prostate	None
6675	34943741	2021	GLWKKIKNVAKAAGKAAKGAL	t-DPH1-6K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 593.7 μM	24-h	Brain	None
6674	34943741	2021	GLWKKIKNVAKAAGKAAKGAL	t-DPH1-6K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-157	Lung Cancer	MTT assay	IC₅₀ = 88.28 μM	24-h	Lung	None
6673	34943741	2021	GLWKKIKNVAKAAGKAAKGAL	t-DPH1-6K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-838	Lung Cancer	MTT assay	IC₅₀ = 186.1 μM	24-h	Lung	None
6672	34943741	2021	GLWKKIKNVAKAAGKAAKGAL	t-DPH1-6K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 55.65 μM	24-h	Prostate	None
6671	34943741	2021	GLWKKIKNVAKAAGKAALGAL	t-DPH1-5K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 2.679 μM	24-h	Brain	None
6670	34943741	2021	GLWKKIKNVAKAAGKAALGAL	t-DPH1-5K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-157	Lung Cancer	MTT assay	IC₅₀ = 1.546 μM	24-h	Lung	None
6669	34943741	2021	GLWKKIKNVAKAAGKAALGAL	t-DPH1-5K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-838	Lung Cancer	MTT assay	IC₅₀ = 1.796 μM	24-h	Lung	None
6668	34943741	2021	GLWKKIKNVAKAAGKAALGAL	t-DPH1-5K	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 2.605 μM	24-h	Prostate	None
6667	34943741	2021	GLWKKIKNVAAAAGKAALGAL	t-DPH1-K4	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 32.18 μM	24-h	Brain	None
6666	34943741	2021	GLWKKIKNVAAAAGKAALGAL	t-DPH1-K4	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-157	Lung Cancer	MTT assay	IC₅₀ = 6.143 μM	24-h	Lung	None
6665	34943741	2021	GLWKKIKNVAAAAGKAALGAL	t-DPH1-K4	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	H-838	Lung Cancer	MTT assay	IC₅₀ = 10.11 μM	24-h	Lung	None
6664	34943741	2021	GLWKKIKNVAAAAGKAALGAL	t-DPH1-K4	21	Linear	L	None	Amidation	Free	Antimicrobial	Analogue of t-DPH1	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 18.99 μM	24-h	Prostate	None
6663	34943741	2021	GLWSKIKNVAAAAGKAALGAL	t-DPH1	21	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa hypochondrialis	U251-MG	Brain Tumor	MTT assay	IC₅₀ = 34.25 μM	24-h	Brain	None
6662	34943741	2021	GLWSKIKNVAAAAGKAALGAL	t-DPH1	21	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa hypochondrialis	H-157	Lung Cancer	MTT assay	IC₅₀ = 10.20 μM	24-h	Lung	None
6661	34943741	2021	GLWSKIKNVAAAAGKAALGAL	t-DPH1	21	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa hypochondrialis	H-838	Lung Cancer	MTT assay	IC₅₀ = 23.51 μM	24-h	Lung	None
6660	34943741	2021	GLWSKIKNVAAAAGKAALGAL	t-DPH1	21	Linear	L	None	Amidation	Free	Antimicrobial	Phyllomedusa hypochondrialis	PC-3	Prostate Cancer	MTT assay	IC₅₀ = 14.67 μM	24-h	Prostate	None
6659	None	2021	ILGKIWKGIVSDF	DN4	13	Linear	L	None	Free	Free	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	191.67 ± 12.02 μM	24-h	Liver	None
6658	None	2021	ILGKIVKKLVSDF	DN1	13	Linear	L	None	Free	Free	Antimicrobial	Synthetic	HepG-2	Liver Cancer	MTT assay	152.17 ± 7.73 μM	24-h	Liver	None
7781	None	2023	KRWHWWRRHWVVW	MAD1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	OVCAR-3	Ovarian Cancer	MTT assay	IC₅₀ = 14.2 μM	48-h	Ovary	US11571454 B2
7782	None	2023	KRWHWWRRHWVVW	MAD1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 36.2 μM	48-h	Lung	US11571454 B2
7783	None	2023	KRWHWWRRHWVVW	MAD1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	NCI/ADR-RES	Ovarian Cancer	MTT assay	IC₅₀ = 85.6 μM	48-h	Ovary	US11571454 B2
7784	None	2023	LWKRWVGVWRKWL	DAP1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	A-549	Lung Cancer	MTT assay	IC₅₀ = 11.9 μM	48-h	Lung	US11571454 B2
7785	None	2023	LWKRWVGVWRKWL	DAP1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	OVCAR-3	Ovarian Cancer	MTT assay	IC₅₀ = 8.6 μM	48-h	Ovary	US11571454 B2
7786	None	2023	LWKRWVGVWRKWL	DAP1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	NCI/ADR-RES	Ovarian Cancer	MTT assay	IC₅₀ = 14.0 μM	48-h	Lung	US11571454 B2
7787	None	2023	LWKRWVGVWRKWL	DAP1	13	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	T-24	Bladder Cancer	MTT assay	IC₅₀ = 15.3 μM	48-h	Bladder	US11571454 B2
7788	None	2023	WKWLKKWIK	AMP1	9	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	OVCAR-3	Ovarian Cancer	MTT assay	IC₅₀ = 51.1 μM	48-h	Ovary	US11571454 B2
7789	None	2023	KRWWKWWRR	AMP2	9	Linear	L	None	Amidation	Free	Antimicrobial	Synthetic	OVCAR-3	Ovarian Cancer	MTT assay	IC₅₀ = 53.5 μM	48-h	Ovary	US11571454 B2
7808	None	2022	YKSIEFC	P1C	7	Linear	L	None	Acetylation	Free	Anticancer	Synthetic	BXPC-3	Pancreatic Cancer	Cell Proliferation assay	~40% reduction in cell growth at 20 μM	72-h	Pancreas	US011214593B2
7809	None	2022	YKSIEFC	P1A	7	Linear	L	None	Free	Free	Anticancer	Synthetic	BXPC-4	Pancreatic Cancer	Cell Proliferation assay	~50% reduction in cell growth at 20 μM	72-h	Pancreas	US011214593B2
7810	None	2022	YKSVEFC	P1B	7	Linear	L	None	Acetylation	Free	Anticancer	Synthetic	BXPC-5	Pancreatic Cancer	Cell Proliferation assay	~50% reduction in cell growth at 20 μM	72-h	Pancreas	US011214593B2
7816	None	2022	LTSVVFILICCFHLENIFVLLKKRTLRKNDRKKR	Sample Peptide 1 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 48% at 25 μM	48-h	Kidney	US011339203B2
7817	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 0.4% at 25 μM	48-h	Kidney	US011339203B2
7818	None	2022	WFLREGSMFVALSASVFSLLAIKKRTLRKNDRKKR	Sample Peptide 3 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 45.8% at 25 μM	48-h	Kidney	US011339203B2
7819	None	2022	FLLISACWVISLILGGLPIMGWKKRTLRKNDRKKR	Sample Peptide 4 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 85.6% at 25 μM	48-h	Kidney	US011339203B2
7820	None	2022	LYHKHYILECTTVFTLLLLSIVILYCRIKKRTLRKNDRKKR	Sample Peptide 5 from US011339203B2	41	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 77.6% at 25 μM	48-h	Kidney	US011339203B2
7821	None	2022	VIIVLSVFIACWAPLFILLLLKKRTLRKNDRKKR	Sample Peptide 6 from US011339203B2	34	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 59.7% at 25 μM	48-h	Kidney	US011339203B2
7822	None	2022	LFRAEYFLVLAVLNSGTNPIIKKRTLRKNDRKKR	Sample Peptide 7 from US011339203B2	34	Linear	L	None	Amidation	Free	Anticancer	Synthetic	CAKI-2	Renal Cancer	CCK-8 assay	Cell Viability = 66.3% at 25 μM	48-h	Kidney	US011339203B2
7823	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	PC-3	Prostate Cancer	CCK-8 assay	Cell Viability = 2.5% at 25 μM	48-h	Kidney	US011339203B2
7824	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-2058	Skin Cancer	CCK-8 assay	Cell Viability = 0.2% at 25 μM	48-h	Skin	US011339203B2
7825	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 assay	Cell Viability = 0.6% at 25 μM	48-h	Lung	US011339203B2
7826	None	2022	FIGNLALSDLLAGVAYTANLLLKKRTLRKNDRKKR	Sample Peptide 2 from US011339203B2	35	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-549	Lung Cancer	CCK-8 assay	Cell Viability = 1.4% at 25 μM	48-h	Lung	US011339203B2
7827	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 / WST-8	Cell Viability = 6.8% at 25 μM	48-h	Lung	EP3604345B1;US11352408B2
7828	None	2023	MQIPQAPWPVVWAVLQLGWRRKKRRQRRR	Sample Peptide 2 from EP3604345B1	29	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 / WST-8	Cell Viability = 3.6% at 25 μM	48-h	Lung	EP3604345B1
7829	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H2444	Lung Cancer	CCK-8 / WST-8	Cell Viability = 87.7% at 25 μM	48-h	Lung	EP3604345B1
7830	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 11.8% at 25 μM	48-h	Lung	EP3604345B1
7831	None	2023	MQIPQAPWPVVWAVLQLGWRRKKRRQRRR	Sample Peptide 2 from EP3604345B1	29	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 4.9% at 25 μM	48-h	Lung	EP3604345B1
7832	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 120.6% at 25 μM	48-h	Lung	EP3604345B1
7833	None	2023	PWWWPPVVVQQQMILLIGAARKKRTLRKNDRKKR	Sample Peptide 4 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 102.6% at 25 μM	48-h	Lung	EP3604345B1
7834	None	2023	KKRTLRKNDRKKR	Sample Peptide 5 from EP3604345B1	13	Linear	L	None	Amidation	Free	Anticancer	Synthetic	HCC-827	Lung Cancer	CCK-8 / WST-8	Cell Viability = 106.5% at 25 μM	48-h	Lung	EP3604345B1
7835	None	2023	MQIPQAPWPVVWAVLQLGWRRKKRRQRRR	Sample Peptide 2 from EP3604345B1	29	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-549	Lung Cancer	CCK-8 / WST-8	Cell Viability = 9.1% at 25 μM	48-h	Lung	EP3604345B1
7836	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H446	Lung Cancer	CCK-8 / WST-8	Cell Viability = 0.5% at 25 μM	48-h	Lung	EP3604345B1
7837	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	NCI-H446	Lung Cancer	CCK-8 / WST-8	Cell Viability = 56.7% at 25 μM	48-h	Lung	EP3604345B1
7838	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-2058	Skin Cancer	CCK-8 / WST-8	Cell Viability = 6.7% at 25 μM	48-h	Skin	EP3604345B1
7839	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	A-2058	Skin Cancer	CCK-8 / WST-8	Cell Viability = 87.5% at 25 μM	48-h	Skin	EP3604345B1
7840	None	2023	MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR	Sample Peptide 1 from EP3604345B1	33	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	CCK-8 / WST-8	Cell Viability = 62.3% at 25 μM	48-h	Breast	EP3604345B1
7841	None	2023	MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR	Sample Peptide 3 from EP3604345B1	31	Linear	L	None	Amidation	Free	Anticancer	Synthetic	MDA-MB-231	Breast Cancer	CCK-8 / WST-8	Cell Viability = 81.7% at 25 μM	48-h	Breast	EP3604345B1
7842	37874670	2023	Not Available	LUNA18	Not Available	Cyclic	L	None	Free	Alkylation	Anticancer and Antitumor	Synthetic	NCI-H2122	NSCLC	CellTiter-Glo Cell Viability assay	IC₅₀ = 1.4 ± 0.3 nmol/L	Not available	Lung	None
7843	37874670	2023	Not Available	LUNA18	Not Available	Cyclic	L	None	Free	Alkylation	Anticancer and Antitumor	Synthetic	MiaPaCa.2	Pancreatic Cancer	CellTiter-Glo Cell Viability assay	IC₅₀ = 1.4 ± 0.2 nmol/L	Not available	Pancreas	None
7844	37874670	2023	Not Available	LUNA18	Not Available	Cyclic	L	None	Free	Alkylation	Anticancer and Antitumor	Synthetic	NCI-H441	NSCLC	CellTiter-Glo Cell Viability assay	IC₅₀ = 2.9 ± 0.7 nmol/L	Not available	Lung	None
7845	37874670	2023	Not Available	LUNA18	Not Available	Cyclic	L	None	Free	Alkylation	Anticancer and Antitumor	Synthetic	LS 180	Colon Cancer	CellTiter-Glo Cell Viability assay	IC₅₀ = 2.7 ± 0.4 nmol/L	Not available	Colon	None
7846	37874670	2023	Not Available	LUNA18	Not Available	Cyclic	L	None	Free	Alkylation	Anticancer and Antitumor	Synthetic	GSU	Stomach Cancer	CellTiter-Glo Cell Viability assay	IC₅₀ = 0.17 ± 0.02 nmol/L	Not available	Stomach	None