Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID100 | ALGISPFHEHAEVVFTANDSGPR | Transthyretin precursor (‘prealbumin’) | Serum | 2451.11 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID158 | VKVLDAVRGSPAIN | Transthyretin (prealbumin) | Plasma | NA | MALDI-TOF | Normal | NA | 17269714 |
| CancerPDF_ID333 | ADDTWEPFASGKTSESGELH | Transthyretin | Plasma | 721.981 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID334 | ADDTWEPFASGK | Transthyretin | Plasma | 662.293 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID335 | DDTWEPFASGKTSESGELH | Transthyretin | Plasma | 698.3033333 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID336 | DDTWEPFASGKTSESGE | Transthyretin | Plasma | 921.8835 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID337 | SPAINVAVHV | Transthyretin | Plasma | 503.7845 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID338 | AINVAVHV | Transthyretin | Plasma | 411.742 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID339 | ASGKTSESGELHGLTTEEEF | Transthyretin | Plasma | 703.654 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID340 | GLTTEEEFVEGIYKVEIDTK | Transthyretin | Plasma | 1150.5775 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID341 | GLTTEEEFVEGIYK | Transthyretin | Plasma | 807.895 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID342 | VEGIYKVEI | Transthyretin | Plasma | 525.294 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID343 | SYSTTAVVTNPKE | Transthyretin | Plasma | 698.848 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1096 | ALGISPFHEHAEVVFTANDSGPR | Transtherin precursor (‘prealbumin’) | Serum | 2451.11 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.02, 1.17 and 3.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID2105 | AADDTWEPFASGK | Transthyretin | Serum | 1393.61501 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2106 | ADDTWEPFASGK | Transthyretin | Serum | 1322.5779 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2107 | ALGISPFHEHAEVVFTANDSGPR | Transthyretin | Serum | 2450.19787 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2108 | YTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 2488.27372 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2109 | GSPAINVAVHVF | Transthyretin | Serum | 1209.65061 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2110 | DDTWEPFASGK | Transthyretin | Serum | 1251.54078 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2111 | AALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 2111.07865 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID3200 | GSPAINVAVHVF | Transthyretin | Plasma | 1209.6506 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3201 | ADDTWEPFASGK | Transthyretin | Plasma | 1322.5779 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3202 | KAADDTWEPFASGK | Transthyretin | Plasma | 1521.71 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3203 | VLDAVRGSPAINVAVHVF | Transthyretin | Plasma | 1863.0367 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3204 | ALGISPFHEHAEVVFTANDSGPR | Transthyretin | Plasma | 2450.1979 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3205 | TSESGELHGLTTEEEFVEGIYK | Transthyretin | Plasma | 2454.1438 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3206 | YTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Plasma | 2488.2737 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3207 | TSESGELHGLTTEEEFVEGIYKVEIDTK | Transthyretin | Plasma | 3139.5085 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID4061 | AALLSPYSYSTTAVVTNPKE | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4406 | AVHVFRKAADDTWEPF | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4683 | DTKSYWKALGISPF | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4741 | EIDTKSYWKALGISPF | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5258 | GPTGTGESKCPLM | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5259 | GPTGTGESKCPLMVKVLDAVRGSPAIN | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5260 | GPTGTGESKCPLMVKVLDAVRGSPAINVA | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5261 | GPTGTGESKCPLMVKVLDAVRGSPAINVAVH | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5430 | IDTKSYWKALGISPFHEHAE | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5935 | LLSPYSYSTTA | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6236 | MVKVLDAVRGSPAINV | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7861 | VKVLDAVRGSPAINV | Transthyretin | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8586 | ALGISPFHEHAEVVFTANDSGPR | Transthyretin | Serum | 2450.2 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8587 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 3156.61 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8588 | ALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 2040.04 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8589 | SYSTTAVVTNPKE | Transthyretin | Serum | 1395.69 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8590 | SYSTTAVVTNPKE | Transthyretin | Serum | 1409.7 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8604 | VKVLDAVRGSPAIN | Prealbumin | Serum | 1437.83 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8605 | VVTNPKE | Prealbumin | Serum | 785.43 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8647 | SGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthretin ( Cterminal fragment of protein TTHY) | Cerbrospinal fluid | NA | MALDI-TOF | Glioblastoma (Malignant brain tumor) | Upregulated in cancer as compare to normal control | 19674866 |
| CancerPDF_ID8675 | ADDTWEPFASGKTSES | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8686 | AEVVFTANDSGPRRYT | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8744 | DDTWEPFASGKTSES | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8863 | GELHGLTTEEEF | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8864 | GELHGLTTEEEFVEG | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8865 | GELHGLTTEEEFVEGI | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8882 | GLTTEEEFVEG | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8997 | KAADDTWEPFASGKTSES | Transthyretin | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9899 | TAVVTNPKE | Transthyretin | Serum | 479.76 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9900 | TTAVVTNPKE | Transthyretin | Serum | 530.27 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9901 | STTAVVTNPKE | Transthyretin | Serum | 573.79 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9902 | YSTTAVVTNPKE | Transthyretin | Serum | 655.31 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9903 | SYSTTAVVTNPKE | Transthyretin | Serum | 698.82 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9904 | YSYSTTAVVTNPKE | Transthyretin | Serum | 780.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9905 | EHAEVVFTANDSGPR | Transthyretin | Serum | 543.59 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9906 | SPYSYSTTAVVTNPKE | Transthyretin | Serum | 872.4 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9907 | HEHAEVVFTANDSGPR | Transthyretin | Serum | 589.28 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9908 | LLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 657.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9909 | YTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 830.43 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9910 | RYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 882.46 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9911 | DSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 790.14 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9912 | FTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 898.48 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9913 | SGPRRYTIAALLSPYSYSTTAVVTNPKE | Transthyretin | Serum | 761.42 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID10088 | KVLDAVRGSPAIN | Transthyretin | Urine | 1339.7643 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10113 | TANDSGPRRYTIA | Transthyretin | Urine | 1421.7142 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10127 | VKVLDAVRGSPAIN | Transthyretin | Urine | 1438.8388 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10183 | VKVLDAVRGSPAINV | Transthyretin | Urine | 1537.8637 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10676 | KVEIDTKSYWKALGISPFHEHAEVVF | Transthyretin | Urine | 3030.571 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10715 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTT | Transthyretin | Urine | 3543.7714 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10721 | FVEGIYKVEIDTKSYWKALGISPFHEHAEVVF | Transthyretin | Urine | 3738.9299 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10724 | AVHVFRKAADDTWEPFASGKTSESGELHGLTTEEE | Transthyretin | Urine | 3831.8486 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10728 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEE | Transthyretin | Urine | 3930.8524 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID10730 | VAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEF | Transthyretin | Urine | 4078.0221 | MALDI-TOF | Muscle-invasive bladder cancer | Differentially expressed between cancer vs normal samples | 21805675 |
| CancerPDF_ID13937 | TAVVTNPKE | Transthyretin | Plasma | 958.521 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |