| Primary information |
|---|
| sequence ID | Seq_2415 |
| Peptide sequence | FTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE |
| CancerPDF_ID | CancerPDF_ID9912, |
| PMID | 21533267 |
| Protein Name | Transthyretin |
| UniprotKB Entry Name | TTHY_HUMAN |
| Fluid | Serum |
| M/Z | 898.48 |
| Charge | 4 |
| Profiling Technique | LC-MS |
| Peptide Identification technique | LC/MS/MS |
| Quantification Technique | Multiple Reaction Monitoring |
| Labelled/Label Free | Label Free |
| FDR | 1.49 |
| CancerPDF_ID | CancerPDF_ID9912, |
| p-Value | NA |
| Software | MASCOT |
| Length | 33 |
| Cancer Type | Lung adenocarcinoma |
| Database | Swissprot Database (57.4) |
| Modification | NA |
| Number of Patients | 62 lung adenocarcinoma and 30 healthy control |
| Regulation | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" |
| Validation | MRM-based validation of 19 candidates |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Peptide Atlas | NA |
| IEDB | NA |