Browse result page of AntiTbPdb
The total number entries retrieved from this search are 738
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1151 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 20% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1152 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1153 | Nisin V | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANVK-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 23% decrease in relative growth as compared to Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1154 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 4 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1155 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 26% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1156 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | Relative growth was reduced by 29% compared to that which occurred in the presence of nisin A. | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1157 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 28% reductions in growth, relative to that brought about by nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1158 | Nisin S | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMS-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 19% decrease in growth as compare to the presence of Nicin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1159 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium smegmatis | Mycobacterium smegmatis MC2155 | 2.7 mm zone of activity as compared to Nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1160 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1161 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium kansasii | Mycobacterium kansasii CIT11/06 | 24% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1162 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium subsp. Hominissuis (CIT05/03) | 16% more inhibition as compared to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1163 | Nisin T | I-(Dhb)-AI-(Dha)-LA-(Abu)-PGAK-(Abu)-GALMGANMT-(Abu)-A-(Abu)-ANASIHV-(Dha)-K | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid, Lanthionine (Ala-S-Ala) formation from 3-7 Ala, and β-methyllanthionine (Abu-S-Ala) from 8-11, 13-19, 23-26, 25-28 in between Abu and Ala | Cyclic (5 hinge region dur to presence of lanthion | 34 | L | NA | Natural | Produced by Lactococcus lactis | Mycobacterium avium | Mycobacterium avium paratuberculosis (ATCC 19698) | 27% decrease in growth relative to nisin A | In vitro | None | NA | NA | None | NA | NA | NA | NA | None | Antibacterial (Shigella, Pseudomonas and Salmonella, S. aureus, S. agalactiae and L. monocytogenes) | 2010 | 21468208 |
| antitb_1164 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 15.8 ± 4.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1165 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 =34.6 ± 22.4 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1166 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 11.0 ± 4.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1167 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 65.8 ± 19.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1168 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 15.2 ± 2.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1169 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 =37.9 ± 15.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1170 | hLFcin1-11 all K | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 39.1 ± 6.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1171 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 14.2 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1172 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 18.9 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1173 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 8.0 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1174 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 22.8 ± 9.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1175 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 12.4 ± 0.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1176 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 = 21.5 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
| antitb_1177 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.7 ± 0.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1178 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 14.4 ± 1.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1179 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 18.0 ± 2.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1180 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 34.4 ± 8.2 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1181 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.8 ± 1.6 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1182 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 19.3 ± 4.8 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
| antitb_1183 | SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | Free | None | Linear | 33 | L | NA | Natural | Isolated from lung cDNA library | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | None | None | 2014 | 25349777 |
| antitb_1184 | H37Rv/SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | 6-histidine | None | Linear | 33 | L | NA | Natural | Expressing SL3-His6X endogenously | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | Endogenously produced with in M.tb | None | 2014 | 25349777 |
| antitb_1185 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 57.7 ± 22.3 μg/ml or 22.1 ± 8.6 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1186 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 86.5 μg/ml or 33.1 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1187 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1188 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1189 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 80.1 ± 24.8 μg/ml or 29 ± 9 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1190 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 17.4 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1191 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin2 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 ± 6.92 μg/ml or 11.92 ± 3.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1192 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 10 ± 3.1 μg/ml or 6 ± 1.8 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1193 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 22 ± 4.9 μg/ml or 11.65 ± 2.59 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1194 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 28.0 ± 9.8 μg/ml or 14.85 ± 5.2 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
| antitb_1195 | Boropentapeptide | AVKAA-B(OH)2 | Free | Conjugated with Boronic acid | Conjugated with Boronic acid | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium thermoresistible | Mycobacterium thermoresistible | Poorer inhibition than Pinanediol PD-protected Boropentapeptide | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1196 | Boropentapeptide | AVKAA-B(OH)2 | Free | Conjugated with Boronic acid | Conjugated with Boronic acid | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | Poorer inhibition than Pinanediol PD-protected Boropentapeptide | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1197 | Boropentapeptide | AVKAA-B(OH)2 | Free | Conjugated with Boronic acid | Conjugated with Boronic acid | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Poorer inhibition than Pinanediol PD-protected Boropentapeptide | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1198 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium thermoresistible | Mycobacterium thermoresistible | IC50 = 121.6 ± 25.3 μM for MycP1 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1199 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | IC50 = 93.2±33.7 μM for MycP2 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1200 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | IC50 = 37.9±5.2 μM for MycP3 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |