Browse result page of AntiTbPdb
The total number entries retrieved from this search are 738
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1875 | GranF2 | VCRTGRSRWRDVCRNFMRRYQSR | Free | Free | None | Linear | 23 | L | Cationic | Protein Derived | Peptide derived from Granulysin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1876 | Dhvar4 | KRLFKKLLFSLRKY | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | Human salivary Histatin derivative | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1877 | Crot(1–9,38–42) | YKQCHKKGGKKGSG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Crotamine, a toxin of Crotalus durissus terrificus | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1878 | CM15 | KWKLFKKIGAVLKVL | Free | Free | None | Linear | 15 | L | Cationic | Synthetic | From Cecropin A and Melittin sequences | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at 18.9 ± 1.71 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1879 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Free | Free | None | Linear | 26 | L | Cationic | Natural | Venom of Apis mellifera | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at 0.339 ± 0.0854 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1880 | OT20 | TKPKGTKPKGTKPKGTKPKG | Free | Free | None | Linear | 20 | L | Cationic | Synthetic | Tetramer derivative of tuftsin sequence | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1881 | Polydim-I | AVAGEKLWLLPHLLKMLLTPTP | Free | Free | None | Linear | 22 | L | Amphipathic | Natural | Isolated from the venom of the Neotropical wasp Polybia dimorpha | Mycobacterium abscessus | Mycobacterium abscessus subsp. massiliense isolates GO 01, GO 06, GO 07, GO 08, GO 13, and GO 18, CRM0020 (Mycobacterium abscessus subsp. massiliense), and ATCC19977 (Mycobacterium abscessus subsp. abscessus) | MIC = 60.8 μg/mL | Both | Peritoneal macrophages, J774 macrophages cells, human red blood cells | Treatment of infected macrophages with 7.6 μg/mL of Polydim-I decreased approximately 50% of the bacterial load | Non-cytotoxic, 10% cytotoxicity on J774 cells at concentrations above 121.6 μg/mL (10%) and concentrations up to 121.6 μg/mL presented less than 2.5% of hemolytic activity | 6 to 8 weeks old BALB/c and IFN-γKO (Knockout) female mice | 2 mg/kg/mLW shows 90% reduction in bacterial load | NA | Cell wall disruption | Cell wall | None | NA | 2016 | 26930596 |
| antitb_1893 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC50 = 15.8 ± 4.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1894 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC90 = 34.6 ± 22.4 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1895 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC50 = 11.0 ± 4.1 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1896 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC90 = 65.8 ± 19.13 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1897 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC50 = 15.2± 2.9 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1898 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC90 = 37.9 ± 15.9 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1899 | Human lactoferricin 1-11 | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1900 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC50 = 14.2 ± 1.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1901 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC90 = 18.9 ± 4.0 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1902 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC50 = 8.0 ± 1.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1903 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC90 = 22.8 ± 9.1 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1904 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC50 = 12.4± 0.3 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1905 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC90 = 21.5± 4.0 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1906 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1907 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1908 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1909 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1910 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1911 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1912 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 8 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1913 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis mc2 6020 | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1914 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG pasteur strain | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
| antitb_1949 | YD-1 | APKGVQGPNG | Free | Amidation | None | Linear | 10 | L | NA | Natural | Derived from Bacillus amyloliquefaciens CBSYD1 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 9341 | MIC = 8 μg/ml | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against gram negative such as Alcaligenes faecalis ATCC 1004, Salmonella Typhimurium KCTC 1925 etc and gram positive bacteria such as Enterococcus faecalis ATCC 29212, Micrococcus luteus ATCC 9341, Staphylococcus aureus KCTC 1928 | 2017 | 28050849 |
| antitb_1950 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO01 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1951 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO06 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1952 | NDBP-5 | IFSAIAGLLSNLL | Free | Free | None | Linear | 13 | L | Cationic | Natural | Derived from scorpion hadrurus gertschi | Mycobacterium abscessus | Mycobacterium abscessus subsp. Massiliene GO08 | MIC = 100 μM | In vitro | Human erythrocyte | NA | No cytotoxicity | BALB/c mice | 2mg/kg | IFN-y production | NA | NA | NA | NA | 2017 | 28275372 |
| antitb_1953 | Wollamide- B | WAlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1954 | Wollamide- B | ALlVNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1955 | Wollamide- B | WLlVAx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 20 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1956 | Wollamide- B | WLlANx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1957 | Wollamide- B | WLaVNx | Free | Free | Third residue is D-alanine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1958 | Wollamide- B | WLlINx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1959 | Wollamide- B | WLlMNx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 80 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1960 | Wollamide- B | WLlVxx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =2.5 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 50 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1961 | Wollamide- B | WLlISx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =15 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1962 | Wollamide- B | WLlIXx | Free | Free | Third residue is D-leucine, fifth residue is tertiary butyl serine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1963 | Wollamide- B | WLlIIx | Free | Free | Third residue is D-leucine and x= ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 3.1 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1964 | Wollamide- B | WLlINr | Free | Free | Third residue is D-leucine and r= D- arginine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 0.6 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1965 | Wollamide- B | xLlVNx | Free | Free | First residue is D- phenyalanine, Third is D-leucine and sixth is D-ornithine | Cyclic | 6 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40 μM | In vitro | HepG2 cell line | NA | Cytoxic above > 100 μM | NA | NA | NA | NA | cell wall pore formation | NA | NA | 2017 | 28423019 |
| antitb_1966 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.2 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1967 | HIDFS2 | GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCY | Free | Free | None | Linear | 34 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |
| antitb_1968 | HIDFS1 | GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR | Free | Free | None | Linear | 37 | L | Cationic | Natural | Derived from Haemaphysalis longicornis | Mycobacterium bovis | Mycobacterium bovis | MIC50 = 0.5 μM | In vitro | A549, 293 T, K562 and THP1 cells | NA | No cytotoxicity at 20 μM | NA | NA | NA | NA | NA | NA | Antiibacterial against Bacillus pumilus, Micrococcus luteus, Pseudomonas aeruginosa, Escherichia coli | 2017 | 28446822 |