| ID | 1609 | |
| PMID | 18031459 | |
| Year | 2007 | |
| Sequence | RKKRRQRRR | |
| Name | Tat-PDT | |
| Length | 9 | |
| N-Terminal Modification | Free | |
| C-Terminal Modification | Free | |
| Linear/ Cyclic | Linear | |
| Chirality | L | |
| Chemical Modification | None | |
| Origin of Peptide | Synthesized using plasmids | |
| Nature of Peptide/Cargo | Not mentioned | |
| Mechanism | Not mentioned | |
| Cargo Sequence/Structure | MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAGITHGMDELYK | |
| Name of cargo | GFP | |
| Assay | Fluorescent microscopy and Confocal microscopy | |
| Enhancer | PBS,Oleic acid | |
| Properties of enhancer | Oleic acid is a chemical enhancer | |
| Concentration | 14uM of GFP mixed with 42µM of peptide | |
| Incubation time | 1-60 minutes | |
| Tissue permeability (value with units) | Best permiability is seen when GFP to peptide ratio is 1:3 and fluorescence microscopy results showed fluorescence in the hypo dermis | |
| Tissue Sample | Backs of mice | |
| Ex vivo/In vivo/In vitro | in vitro | |
| STRUCTURE |
| |
| SMILES | N[C@@H](CCCNC(=[NH2])N)C(=O)N[C@@H] (CCCC[NH3])C(=O)N[C@@H](CCCC[NH3])C(=O) N[C@@H](CCCNC(=[NH2])N)C(=O)N[C@@H](CCC NC(=[NH2])N)C(=O)N[C@@H](CCC(=O)N) C(=O)N[C@@H](CCCNC(=[NH2])N)C(=O) N[C@@H](CCCNC(=[NH2])N)C(=O)N [C@@H](CCCNC(=[NH2])N)C=O | |