This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb14224. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb14224 |
| Sequence | FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 4 (apd2, camp, hemolytik, yadamp) |
| Link to Source | apd2_AP00772, camp_CAMPSQ246, hemolytik_2182, hemolytik_2183, hemolytik_2184, hemolytik_2351, hemolytik_2352, hemolytik_2353, hemolytik_4067, hemolytik_4068, hemolytik_4069, hemolytik_4070, yadamp_1913, |
| Major Functions | 3 (antibacterial, toxic, antimicrobial,) |
| Sub-functions | hemolytic |
| Additional Info | insecticidal, |
| Helix (%) | 93.8 |
| Strand (%) | 0 |
| Coil (%) | 6.2 |
| Turn (%) | 0 |
| DSSP states | CHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (I-TASSER) |