Primary information |
---|
Hemolytik ID | 2184 |
PMID | 11976325 |
YEAR | 2002 |
SEQUENCE | FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ |
LENGTH | 48 |
NAME | Oxyopinin 1 |
C-ter Modification | Free |
N-ter Modification | Free |
Linear/Cyclic | Linear |
Stereochemistry | L |
Modified Residues | None |
FUNCTION | Antimicrobial and Insecticidal |
ACTIVITY | ~40% hemolysis at 50μM |
RBCs SOURCE | Sheep |
Secondary information |
---|
Properties | Physico-Chemical details |
STRUCTURE | |
DSSP states | CCCTHHHHTTHHHHHHHHHHHHCHHHHHHHHHHHHHHSCTTHHHHTTC |
SMILES | N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCN=C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCN=C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCN=C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O |
External Links |
---|
PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
NA |
NA |
P83247 |
NA |
NA |
NA |
NA |
NA |
|
Reference Informaiton |
---|
ARTICLE | Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins. |
AUTHORS | Corzo G,Villegas E,Gomez-Lagunas F,Possani LD,Belokoneva OS |
JOURNAL | J Biol Chem. 2002 Jun 28;277(26):23627-37. Epub 2002 Apr 25. |