| Primary information |
|---|
| Hemolytik ID | 2182 |
| PMID | 11976325 |
| YEAR | 2002 |
| SEQUENCE | FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ |
| LENGTH | 48 |
| NAME | Oxyopinin 1 |
| C-ter Modification | Free |
| N-ter Modification | Free |
| Linear/Cyclic | Linear |
| Stereochemistry | L |
| Modified Residues | None |
| FUNCTION | Antimicrobial and Insecticidal |
| ACTIVITY | ~90% hemolysis at 50μM |
| RBCs SOURCE | Pig |
| Secondary information |
|---|
| Properties | Physico-Chemical details |
| STRUCTURE | |
| DSSP states | CCCTHHHHTTHHHHHHHHHHHHCHHHHHHHHHHHHHHSCTTHHHHTTC |
| SMILES | N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCN=C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCN=C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCN=C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O |
| External Links |
|---|
| PDB exact | PDB partial | SP exact | SP partial | TrEMBL exact | TrEMBL partial | IEDB exact | IEDB partial |
| NA |
NA |
P83247 |
NA |
NA |
NA |
NA |
NA |
|
| Reference Informaiton |
|---|
| ARTICLE | Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins. |
| AUTHORS | Corzo G,Villegas E,Gomez-Lagunas F,Possani LD,Belokoneva OS |
| JOURNAL | J Biol Chem. 2002 Jun 28;277(26):23627-37. Epub 2002 Apr 25. |