Browse result page of FermFooDB Database

This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.

The total number entries retrieved from this search are 7

FMDB_IDPubMed IDReferenceTitlePeptide_SequenceSequenceLength of peptideFood_Matrix Protein pHTemperatureIncubation TimeActivityExperimentModelAssay for Activity MeasurementCultureHydrolysisMethod of analysisM_Z ratioMassIC50
FMDB34221787916NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17mexican frescocheese WSEβ-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS941.4 (+2) 1880.2810.4 ± 0.40 ug/ml
FMDB34321787916NANARPKHPIKHQGLPQEVRPKHPIKHQGLPQEV15mexican frescocheese WSEαS1-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS945.2 (+2) 1893.3810.4 ± 0.40 ug/ml
FMDB34421787916NANARPKHPIKHQGLPQEVLNENLLRRPKHPIKHQGLPQEVLNENLLR22mexican frescocheese WSEαS1-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS922.3 (+2) 2763.8710.4 ± 0.40 ug/ml
FMDB34521787916NANAFVAPFPEVFGKFVAPFPEVFGK11mexican frescocheese WSEαS1-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS619.5 (+2) 1236.910.4 ± 0.40 ug/ml
FMDB34621787916NANAEVLNENLLRFEVLNENLLRF10mexican frescocheese WSEαS1-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS624.2 (+2) 1246.2210.4 ± 0.40 ug/ml
FMDB34721787916NANAYQEPVLGPVRGPFYQEPVLGPVRGPF13mexican frescocheese WSEβ-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS729.9 (+2) 1457.810.4 ± 0.40 ug/ml
FMDB34821787916NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17mexican frescocheese WSEβ-CaseinNA34C &4CAfter 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripeningAce-inhibitoryIn vitroNAspectrophotometeric assay using HHL as substrateEnterococcus faeciumproteinase and peptidaseLC-ESI-MS941.7 (+2) 1881.4610.4 ± 0.40 ug/ml