Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 60| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB1129 | 23806758 | NA | NA | VGGASLKPEF | VGGASLKPEF | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 502.78+2 | NA | NA |
| FMDB1130 | 23806758 | NA | NA | VGLDTTKF | VGLDTTKF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 440.75+2 | NA | NA |
| FMDB1131 | 23806758 | NA | NA | EVGGEALGRL | EVGGEALGRL | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 500.78+2 | NA | NA |
| FMDB1132 | 23806758 | NA | NA | QLGKAGIM | QLGKAGIM | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 417.27+2 | NA | NA |
| FMDB1133 | 23806758 | NA | NA | ASDPIL | ASDPIL | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 615.34+1 | NA | NA |
| FMDB1134 | 23806758 | NA | NA | ASDPILYRPVA | ASDPILYRPVA | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 601.34+2 | NA | NA |
| FMDB1135 | 23806758 | NA | NA | PILYRPVA | PILYRPVA | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 464.79+2 | NA | NA |
| FMDB1136 | 23806758 | NA | NA | SKHPGDFGAD | SKHPGDFGAD | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 515.73+2 | NA | NA |
| FMDB1137 | 23806758 | NA | NA | IVPIVE | IVPIVE | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 669.42+1 | NA | NA |
| FMDB1138 | 23806758 | NA | NA | AAVYKALSDHHIY | AAVYKALSDHHIY | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 496.6+3 | NA | NA |
| FMDB1139 | 23806758 | NA | NA | LSGGQSEEEASINL | LSGGQSEEEASINL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 717.37+2 | NA | NA |
| FMDB1140 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1141 | 23806758 | NA | NA | SPLPVIPH | SPLPVIPH | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 430.26+2 | NA | NA |
| FMDB1142 | 23806758 | NA | NA | KLDVKGKRVVM | KLDVKGKRVVM | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 430.27+2 | NA | NA |
| FMDB1143 | 23806758 | NA | NA | MSHLGRPD | MSHLGRPD | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 464.72+2 | NA | NA |
| FMDB1144 | 23806758 | NA | NA | IKWGDAGATY | IKWGDAGATY | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 541.28+2 | NA | NA |
| FMDB1145 | 23806758 | NA | NA | GDAGATY | GDAGATY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 654.28 | NA |
| FMDB1146 | 23806758 | NA | NA | VVESTGVF | VVESTGVF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 837.44 | NA |
| FMDB1147 | 23806758 | NA | NA | GYSNRVVDL | GYSNRVVDL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 511.77+2 | NA | NA |
| FMDB1148 | 23806758 | NA | NA | AMQKIF | AMQKIF | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 377.2+2 | NA | NA |
| FMDB1149 | 23806758 | NA | NA | DSRGNPTVEVD | DSRGNPTVEVD | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 594.79+2 | NA | NA |
| FMDB1150 | 23806758 | NA | NA | KVVIGM | KVVIGM | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 331.7+2 | NA | NA |
| FMDB1151 | 23806758 | NA | NA | VVIGM | VVIGM | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 534.3 | NA |
| FMDB1152 | 23806758 | NA | NA | IKNYPVVSIED | IKNYPVVSIED | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 638.85+2 | NA | NA |
| FMDB1153 | 23806758 | NA | NA | NTNHGRILL | NTNHGRILL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 519.3+2 | NA | NA |
| FMDB1154 | 23806758 | NA | NA | GTHIAKTL | GTHIAKTL | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 420.75+2 | NA | NA |
| FMDB1155 | 23806758 | NA | NA | PSAVAKHFVA | PSAVAKHFVA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 513.79+2 | NA | NA |
| FMDB1156 | 23806758 | NA | NA | VIQTGVD | VIQTGVD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 731.4 | NA |
| FMDB1157 | 23806758 | NA | NA | VGSVF | VGSVF | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 508.28 | NA |
| FMDB1158 | 23806758 | NA | NA | GGKDQRLP | GGKDQRLP | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 435.77+2 | NA | NA |
| FMDB1159 | 23806758 | NA | NA | LVGGASLKPEF | LVGGASLKPEF | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 559.33 | NA |
| FMDB1160 | 23806758 | NA | NA | KSLLGK | KSLLGK | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 323.22+2 | NA | NA |
| FMDB1161 | 23806758 | NA | NA | KSLLGKD | KSLLGKD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 380.74+2 | NA | NA |
| FMDB1162 | 23806758 | NA | NA | KSLLGKDVL | KSLLGKDVL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 486.82+2 | NA | NA |
| FMDB1163 | 23806758 | NA | NA | LEGKVLPGVDALS | LEGKVLPGVDALS | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 649.39+2 | NA | NA |
| FMDB1164 | 23806758 | NA | NA | PFGNTHNKYKLNF | PFGNTHNKYKLNF | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 527.28+3 | NA | NA |
| FMDB1165 | 23806758 | NA | NA | PGHPFIM | PGHPFIM | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 407.71+2 | NA | NA |
| FMDB1166 | 23806758 | NA | NA | IDDHFL | IDDHFL | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 380.2+2 | NA | NA |
| FMDB1167 | 23806758 | NA | NA | KPVSPLL | KPVSPLL | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 377.25+2 | NA | NA |
| FMDB1168 | 23806758 | NA | NA | TAAVGSVF | TAAVGSVF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 751.42 | NA |
| FMDB1169 | 23806758 | NA | NA | YVTAIRNL | YVTAIRNL | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 475.292+ | NA |
| FMDB1170 | 23806758 | NA | NA | VILFH | VILFH | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 314.7+2 | NA | NA |
| FMDB1171 | 23806758 | NA | NA | AAVYKALSDHHIYL | AAVYKALSDHHIYL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 534.3+3 | NA | NA |
| FMDB1172 | 23806758 | NA | NA | YKALSDHHIYL | YKALSDHHIYL | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 453.92+3 | NA | NA |
| FMDB1173 | 23806758 | NA | NA | VDTSKGFLID | VDTSKGFLID | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 547.8+2 | NA | NA |
| FMDB1174 | 23806758 | NA | NA | PILYRPVAVA | PILYRPVAVA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 549.85+2 | NA | NA |
| FMDB1175 | 23806758 | NA | NA | QQAVRAIVSCFPN | QQAVRAIVSCFPN | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 478.26+3 | NA | NA |
| FMDB1176 | 23806758 | NA | NA | QLVMFVLQL | QLVMFVLQL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 545.83+2 | NA | NA |
| FMDB1907 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1908 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1909 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1910 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1923 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1924 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1925 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1938 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1939 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1940 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1954 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1955 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |