Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID78 | ISASAEELRQRLAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 2508.16 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID79 | LAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 634.29 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID80 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 1771.81 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID81 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 2599.18 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID82 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 2755.2 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID83 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1927.94 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID84 | DVSSALDKLKEFGNTLEDKARELIS | Apolipoprotein C-I | Serum | 2778.15 | MALDI-TOF | Metastatic thyroid carcinomas | NA | 16896061 |
| CancerPDF_ID349 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 919.12 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID350 | SLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Plasma | 695.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID351 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | "964.48, 643.32" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID352 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 886.43 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID353 | SLAELGGHLDQQ | Apolipoprotein A-IV | Plasma | 634.31 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID354 | AELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 864.42 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID355 | ELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 828.9 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID356 | ELGGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 750.85 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID357 | GGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 707.84 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID358 | GGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 629.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID359 | LAPLAEDVRGNLR | Apolipoprotein A-IV | Plasma | 712.4 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID360 | LAPLAEDVRGNL | Apolipoprotein A-IV | Plasma | 634.35 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID361 | LAPLAEDVR | Apolipoprotein A-IV | Plasma | 492.28 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID362 | TLSLPELEQQ | Apolipoprotein A-IV | Plasma | 579.3 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID363 | TLSLPELEQ | Apolipoprotein A-IV | Plasma | 515.27 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID364 | SLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Plasma | 1108.19 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID365 | SLPELEQQQEQQQEQQQEQVQ | Apolipoprotein A-IV | Plasma | 861.07 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID366 | SLPELEQQQEQQQEQQQ | Apolipoprotein A-IV | Plasma | 1049.48 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID367 | SLPELEQQQEQQQ | Apolipoprotein A-IV | Plasma | 792.88 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID368 | ISASAEELRQR | Apolipoprotein A-IV | Plasma | 630.34 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID369 | ISASAEELR | Apolipoprotein A-IV | Plasma | 488.26 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID370 | ADEFKVKIDQTVEELR | Apolipoprotein A-IV | Plasma | "960.50, 640.67" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID371 | DEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 846.94 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID372 | KVKIDQTVEELR | Apolipoprotein A-IV | Plasma | 486.61 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID373 | VKIDQTVEELR | Apolipoprotein A-IV | Plasma | 665.37 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID374 | KIDQTVEELR | Apolipoprotein A-IV | Plasma | 615.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID375 | IDQTVEELR | Apolipoprotein A-IV | Plasma | 551.79 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID376 | RVEPYGENFNK | Apolipoprotein A-IV | Plasma | "676.83, 451.55" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID377 | RVEPYGENFN | Apolipoprotein A-IV | Plasma | 611.78 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID378 | GENFNKALVQQMEQL | Apolipoprotein A-IV | Plasma | "874.93, 583.62" | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID379 | GDVEGHLSFLEKDLR | Apolipoprotein A-IV | Plasma | 572.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID380 | GDVEGHLSF | Apolipoprotein A-IV | Plasma | 480.72 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID381 | DQLRTQVSTQAEQL | Apolipoprotein A-IV | Plasma | 808.91 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID382 | TQVSTQAEQLR | Apolipoprotein A-IV | Plasma | 630.83 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID383 | LFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Plasma | 955.98 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID384 | LFQDKLGEVNTY | Apolipoprotein A-IV | Plasma | 713.86 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID385 | LLPHANEVSQ | Apolipoprotein A-IV | Plasma | 554.29 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID386 | IGDNLRELQQRLEPY | Apolipoprotein A-IV | Plasma | 615.32 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID387 | SELTQQLNALF | Apolipoprotein A-IV | Plasma | 632.33 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID388 | SLAPYAQDTQEKLNHQLEGL | Apolipoprotein A-IV | Plasma | 752.38 | LC-MS | Ductal adenocarcinoma of the pancreas (DAP) | NA | 19795908 |
| CancerPDF_ID1077 | ISASAEELRQRLAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 2508.16 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.38, 1.2 and 7.96 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1078 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 1771.81 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =148, 220 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1079 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 2599.18 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1080 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 2755.2 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.11, 12.37 and 1.22 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1081 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1927.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =79, 671 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1354 | LAEDVRGN | Apolipoprotein A-IV | Serum | 872.43519 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1355 | ASAEELRQ | Apolipoprotein A-IV | Serum | 902.44576 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1356 | ISASAEELR | Apolipoprotein A-IV | Serum | 974.50327 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1357 | LAPLAEDVR | Apolipoprotein A-IV | Serum | 982.54475 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1358 | LAEDVRGNL | Apolipoprotein A-IV | Serum | 985.51926 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1359 | SASAEELRQ | Apolipoprotein A-IV | Serum | 989.47779 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1360 | APLAEDVRGN | Apolipoprotein A-IV | Serum | 1040.52507 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1361 | IDQNVEELK | Apolipoprotein A-IV | Serum | 1086.5557 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1362 | ISASAEELRQ | Apolipoprotein A-IV | Serum | 1102.56185 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1363 | LAPLAEDVRGN | Apolipoprotein A-IV | Serum | 1153.60914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1364 | QVNTQAEQLR | Apolipoprotein A-IV | Serum | 1185.6102 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1365 | KIDQTVEELR | Apolipoprotein A-IV | Serum | 1229.66157 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1366 | VKIDQTVEELR | Apolipoprotein A-IV | Serum | 1328.72998 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1367 | ARISASAEELRQR | Apolipoprotein A-IV | Serum | 1485.80119 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1368 | AKIDQNVEELKGR | Apolipoprotein A-IV | Serum | 1498.81036 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1369 | ELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1655.79035 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1370 | AEDVRGNLR | Apolipoprotein A-IV | Serum | 1028.53631 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1371 | VKIDQTVEEL | Apolipoprotein A-IV | Serum | 1172.62887 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1372 | KIDQNVEELK | Apolipoprotein A-IV | Serum | 1214.65067 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1373 | PLAEDVRGNLR | Apolipoprotein A-IV | Serum | 1238.67313 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1374 | ISASAEELRQR | Apolipoprotein A-IV | Serum | 1258.66296 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1375 | LAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 1266.6932 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1376 | TQVNTQAEQLR | Apolipoprotein A-IV | Serum | 1286.65788 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1377 | APLAEDVRGNLR | Apolipoprotein A-IV | Serum | 1309.71025 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1378 | GGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1413.66369 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1379 | LAPLAEDVRGNLR | Apolipoprotein A-IV | Serum | 1422.79431 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1380 | LAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1839.91153 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1381 | AELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 1882.92857 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1382 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1926.94355 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1383 | ENADSLQASLRPHADELK | Apolipoprotein A-IV | Serum | 1992.98648 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1384 | SLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 2083.04467 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1385 | LTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Serum | 2393.24784 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1386 | GRLTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Serum | 2606.37042 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1387 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 2754.35729 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1388 | RVEPYGENFNKALVQQMEQLRQK | Apolipoprotein A-IV | Serum | 2804.43918 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1389 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 2910.4584 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1390 | AELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1726.82746 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1391 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 1770.84244 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1392 | PYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Serum | 2179.1161 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1393 | SLAPYAQDTQEKLNHQLEGLTFQMK | Apolipoprotein A-IV | Serum | 2889.43309 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1394 | SLAPYAQDTQEKLNHQLEGLTFQM | Apolipoprotein A-IV | Serum | 2777.33304 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1395 | TLSLPELEQQQEQQQEQQQEQVQMLAPLES | Apolipoprotein A-IV | Serum | 3536.69407 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1396 | GNTEGLQK | Apolipoprotein A-IV | Serum | 845.4243 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1397 | AKIDQNVEELK | Apolipoprotein A-IV | Serum | 1285.68778 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1398 | LAEDVRGNLR | Apolipoprotein A-IV | Serum | 1141.62037 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1399 | LDQQVEEFR | Apolipoprotein A-IV | Serum | 1162.56185 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1400 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 2598.25617 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1401 | SASAEELR | Apolipoprotein A-IV | Serum | 861.41921 | LC-MS | Colorectal cancer | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID1402 | APLAEDVR | Apolipoprotein A-IV | Serum | 869.46068 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1403 | TPYADEFK | Apolipoprotein A-IV | Serum | 969.44436 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1404 | DQNVEELK | Apolipoprotein A-IV | Serum | 973.47164 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1405 | TQVNTQAEQL | Apolipoprotein A-IV | Serum | 1130.55677 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1406 | AKIDQNVEEL | Apolipoprotein A-IV | Serum | 1157.59282 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1407 | AKIDQNVEELKG | Apolipoprotein A-IV | Serum | 1342.70924 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1408 | RVEPYGENFNK | Apolipoprotein A-IV | Serum | 1351.65206 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1409 | GRLTPYADEFKV | Apolipoprotein A-IV | Serum | 1394.71942 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1410 | KIDQNVEELKGR | Apolipoprotein A-IV | Serum | 1427.77324 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1411 | ARLLPHANEVSQK | Apolipoprotein A-IV | Serum | 1461.80521 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1412 | RQLTPYAQRMER | Apolipoprotein A-IV | Serum | 1547.79908 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1413 | TQVNTQAEQ | Apolipoprotein A-IV | Serum | 1017.4727 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1414 | DQNVEELKG | Apolipoprotein A-IV | Serum | 1030.4931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1415 | RVEPYGENFN | Apolipoprotein A-IV | Serum | 1223.5571 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1416 | RLTPYADEFK | Apolipoprotein A-IV | Serum | 1238.62954 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1417 | GRLTPYADEFK | Apolipoprotein A-IV | Serum | 1295.651 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1418 | SLAPYAQDTQEK | Apolipoprotein A-IV | Serum | 1349.64631 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1419 | NAEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 2014.04433 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1420 | AKIDQNVEELKGRLTPYADEFK | Apolipoprotein A-IV | Serum | 2563.32822 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1421 | ALVQQMEQLRQK | Apolipoprotein A-IV | Serum | 1470.79768 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1422 | VLRENADSLQASLRPHADEL | Apolipoprotein A-IV | Serum | 2233.14511 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1423 | LEPYADQLRTQVNTQAEQLR | Apolipoprotein A-IV | Serum | 2372.20844 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1424 | GRLTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Serum | 2450.26931 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1425 | IDQTVEELR | Apolipoprotein A-IV | Serum | 1101.5666 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1426 | QLTPYAQRME | Apolipoprotein A-IV | Serum | 1235.59686 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1427 | IDQNVEELKGR | Apolipoprotein A-IV | Serum | 1299.67828 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1428 | DQTVEELR | Apolipoprotein A-IV | Serum | 988.48254 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1429 | TPYAQRME | Apolipoprotein A-IV | Serum | 994.45422 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1430 | IDQNVEELKG | Apolipoprotein A-IV | Serum | 1143.57717 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1431 | APLAEDVRGNL | Apolipoprotein A-IV | Serum | 1153.60914 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1432 | QRLAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 1550.85289 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1433 | KIDQTVEEL | Apolipoprotein A-IV | Serum | 1073.56045 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1434 | PLAEDVRGNL | Apolipoprotein A-IV | Serum | 1082.57202 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1435 | GRLTPYADEF | Apolipoprotein A-IV | Serum | 1167.55604 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1436 | DQNVEELKGR | Apolipoprotein A-IV | Serum | 1186.59421 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1437 | LVQQMEQLRQ | Apolipoprotein A-IV | Serum | 1271.66561 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1438 | LTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Serum | 2237.14673 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1439 | LGEVNTYAGDLQK | Apolipoprotein A-IV | Serum | 1406.70416 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1440 | ENADSLQASLRPHADEL | Apolipoprotein A-IV | Serum | 1864.89152 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1441 | VLRENADSLQASLRPHADELK | Apolipoprotein A-IV | Serum | 2361.24007 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1442 | RVEPYGENFNKALVQQMEQL | Apolipoprotein A-IV | Serum | 2392.18453 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1443 | AKIDQNVEELKGRLTPYADEF | Apolipoprotein A-IV | Serum | 2435.23325 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1444 | SLAPYAQDTQEKLNHQLEGLTFQM | Apolipoprotein A-IV | Serum | 2761.33813 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1445 | RLLPHANEVSQK | Apolipoprotein A-IV | Serum | 1390.7681 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1446 | VNTQAEQLR | Apolipoprotein A-IV | Serum | 1057.55162 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1447 | RQLTPYAQRME | Apolipoprotein A-IV | Serum | 1391.69797 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1448 | RVEPYGENFNKALVQQMEQLR | Apolipoprotein A-IV | Serum | 2548.28564 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1449 | RVEPYGENFNKALVQQMEQLRQ | Apolipoprotein A-IV | Serum | 2676.34422 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1450 | IGDNLRELQQRLEPYADQLR | Apolipoprotein A-IV | Serum | 2426.26662 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1451 | KIDQNVEEL | Apolipoprotein A-IV | Serum | 1086.5557 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1452 | KIDQNVEELKG | Apolipoprotein A-IV | Serum | 1271.67213 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1453 | NAEELKA | Apolipoprotein A-IV | Serum | 773.39193 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1454 | ASAEELR | Apolipoprotein A-IV | Serum | 774.38718 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1455 | IGDNLRELQ | Apolipoprotein A-IV | Serum | 1056.55637 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID1456 | LLPHANEVSQK | Apolipoprotein A-IV | Serum | 1234.66699 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2166 | EALQGVGDMGR | Serum amyloid A-4 protein | Serum | 1131.53426 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2167 | SNEKAEEWGR | Serum amyloid A-4 protein | Serum | 1204.54726 | LC-MS | Colorectal cancer | NA | 21136997 |
| CancerPDF_ID2550 | YADEFKV | Apolipoprotein A-IV | Plasma | 870.4123 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2551 | TPYADEFK | Apolipoprotein A-IV | Plasma | 969.4444 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2552 | ISASAEELR | Apolipoprotein A-IV | Plasma | 974.5033 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2553 | QLTPYAQR | Apolipoprotein A-IV | Plasma | 975.5138 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2554 | LAEDVRGNL | Apolipoprotein A-IV | Plasma | 985.5193 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2555 | SASAEELRQ | Apolipoprotein A-IV | Plasma | 989.4778 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2556 | FATELHER | Apolipoprotein A-IV | Plasma | 1001.493 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2557 | AEDVRGNLR | Apolipoprotein A-IV | Plasma | 1028.5363 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2558 | ALVQQMEQL | Apolipoprotein A-IV | Plasma | 1058.543 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2559 | QQMEQLRQ | Apolipoprotein A-IV | Plasma | 1059.5131 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2560 | KIDQTVEEL | Apolipoprotein A-IV | Plasma | 1073.5604 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2561 | KIDQNVEEL | Apolipoprotein A-IV | Plasma | 1086.5557 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2562 | IDQTVEELR | Apolipoprotein A-IV | Plasma | 1101.5666 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2563 | ISASAEELRQ | Apolipoprotein A-IV | Plasma | 1102.5618 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2564 | LLPHANEVSQ | Apolipoprotein A-IV | Plasma | 1106.572 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2565 | TQVNTQAEQL | Apolipoprotein A-IV | Plasma | 1130.5568 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2566 | IDQNVEELKG | Apolipoprotein A-IV | Plasma | 1143.5772 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2567 | SASAEELRQR | Apolipoprotein A-IV | Plasma | 1145.5789 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2568 | AKIDQNVEEL | Apolipoprotein A-IV | Plasma | 1157.5928 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2569 | VQQMEQLRQ | Apolipoprotein A-IV | Plasma | 1158.5815 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2570 | GRLTPYADEF | Apolipoprotein A-IV | Plasma | 1167.556 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2571 | VKIDQTVEEL | Apolipoprotein A-IV | Plasma | 1172.6289 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2572 | DKVNSFFSTF | Apolipoprotein A-IV | Plasma | 1190.5608 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2573 | ARISASAEELR | Apolipoprotein A-IV | Plasma | 1201.6415 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2574 | RVEPYGENFN | Apolipoprotein A-IV | Plasma | 1223.5571 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2575 | KIDQTVEELR | Apolipoprotein A-IV | Plasma | 1229.6616 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2576 | IDQTVEELRR | Apolipoprotein A-IV | Plasma | 1257.6677 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2577 | ISASAEELRQR | Apolipoprotein A-IV | Plasma | 1258.663 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2578 | RLLPHANEVSQ | Apolipoprotein A-IV | Plasma | 1262.6731 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2579 | LAPLAEDVRGNL | Apolipoprotein A-IV | Plasma | 1266.6932 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2580 | LVQQMEQLRQ | Apolipoprotein A-IV | Plasma | 1271.6656 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2581 | KIDQNVEELKG | Apolipoprotein A-IV | Plasma | 1271.6721 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2582 | AKIDQNVEELK | Apolipoprotein A-IV | Plasma | 1285.6878 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2583 | TQVNTQAEQLR | Apolipoprotein A-IV | Plasma | 1286.6579 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2584 | GRLTPYADEFK | Apolipoprotein A-IV | Plasma | 1295.651 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2585 | APLAEDVRGNLR | Apolipoprotein A-IV | Plasma | 1309.7102 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2586 | VKIDQTVEELR | Apolipoprotein A-IV | Plasma | 1328.73 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2587 | ARLLPHANEVSQ | Apolipoprotein A-IV | Plasma | 1333.7102 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2588 | AKIDQNVEELKG | Apolipoprotein A-IV | Plasma | 1342.7092 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2589 | SLAPYAQDTQEK | Apolipoprotein A-IV | Plasma | 1349.6463 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2590 | RVEPYGENFNK | Apolipoprotein A-IV | Plasma | 1351.6521 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2591 | RQLTPYAQRME | Apolipoprotein A-IV | Plasma | 1391.698 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2592 | GRLTPYADEFKV | Apolipoprotein A-IV | Plasma | 1394.7194 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2593 | LAPLAEDVRGNLR | Apolipoprotein A-IV | Plasma | 1422.7943 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2594 | KIDQNVEELKGR | Apolipoprotein A-IV | Plasma | 1427.7732 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2595 | LKEEIGKELEEL | Apolipoprotein A-IV | Plasma | 1428.7712 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2596 | KLVPFATELHER | Apolipoprotein A-IV | Plasma | 1438.7932 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2597 | ARLLPHANEVSQK | Apolipoprotein A-IV | Plasma | 1461.8052 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2598 | ALVQQMEQLRQK | Apolipoprotein A-IV | Plasma | 1470.7977 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2599 | LVPFATELHERLA | Apolipoprotein A-IV | Plasma | 1494.8195 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2600 | AKIDQNVEELKGR | Apolipoprotein A-IV | Plasma | 1498.8104 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2601 | RRVEPYGENFNK | Apolipoprotein A-IV | Plasma | 1507.7532 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2602 | GRLTPYADEFKVK | Apolipoprotein A-IV | Plasma | 1522.8144 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2603 | QRLAPLAEDVRGNL | Apolipoprotein A-IV | Plasma | 1550.8529 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2604 | KLVPFATELHERLA | Apolipoprotein A-IV | Plasma | 1622.9144 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2605 | SELTQQLNALFQDK | Apolipoprotein A-IV | Plasma | 1633.8312 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2606 | QRLAPLAEDVRGNLR | Apolipoprotein A-IV | Plasma | 1706.954 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2607 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 1770.8424 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2608 | LGPHAGDVEGHLSFLEK | Apolipoprotein A-IV | Plasma | 1804.9108 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2609 | ENADSLQASLRPHADEL | Apolipoprotein A-IV | Plasma | 1864.8915 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2610 | DSEKLKEEIGKELEEL | Apolipoprotein A-IV | Plasma | 1887.9677 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2611 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 1926.9436 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2612 | ENADSLQASLRPHADELK | Apolipoprotein A-IV | Plasma | 1992.9865 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2613 | LGPHAGDVEGHLSFLEKDL | Apolipoprotein A-IV | Plasma | 2033.0218 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2614 | DSEKLKEEIGKELEELR | Apolipoprotein A-IV | Plasma | 2044.0688 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2615 | SLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Plasma | 2083.0447 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2616 | DKVNSFFSTFKEKESQDK | Apolipoprotein A-IV | Plasma | 2163.0484 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2617 | LGPHAGDVEGHLSFLEKDLR | Apolipoprotein A-IV | Plasma | 2189.1229 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2618 | LAKDSEKLKEEIGKELEEL | Apolipoprotein A-IV | Plasma | 2200.1838 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2619 | LEPYADQLRTQVNTQAEQL | Apolipoprotein A-IV | Plasma | 2216.1073 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2620 | VLRENADSLQASLRPHADEL | Apolipoprotein A-IV | Plasma | 2233.1451 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2621 | LTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 2237.1467 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2622 | IGDNLRELQQRLEPYADQL | Apolipoprotein A-IV | Plasma | 2270.1655 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2623 | VLRENADSLQASLRPHADELK | Apolipoprotein A-IV | Plasma | 2361.2401 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2624 | LEPYADQLRTQVNTQAEQLR | Apolipoprotein A-IV | Plasma | 2372.2084 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2625 | LGPHAGDVEGHLSFLEKDLRDK | Apolipoprotein A-IV | Plasma | 2432.2448 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2626 | VLRENADSLQASLRPHADELKA | Apolipoprotein A-IV | Plasma | 2432.2772 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2627 | GRLTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 2450.2693 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2628 | AKIDQNVEELKGRLTPYADEFK | Apolipoprotein A-IV | Plasma | 2563.3282 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2629 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Plasma | 2598.2562 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2630 | GRLTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Plasma | 2606.3704 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2631 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 2754.3573 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2632 | SLAPYAQDTQEKLNHQLEGLTFQM | Apolipoprotein A-IV | Plasma | 2761.3381 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2633 | RVEPYGENFNKALVQQMEQLRQK | Apolipoprotein A-IV | Plasma | 2804.4392 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2634 | SLAPYAQDTQEKLNHQLEGLTFQMK | Apolipoprotein A-IV | Plasma | 2889.4331 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2635 | SELTQQLNALFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Plasma | 2894.4298 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2636 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Plasma | 2910.4584 | LC-MS | Normal | Differentially expressed between cancer vs normal | 21136997 |
| CancerPDF_ID2637 | RGNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Plasma | 2910.4584 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2638 | SELTQQLNALFQDKLGEVNTYAGDLQK | Apolipoprotein A-IV | Plasma | 3022.5247 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2639 | IGDNLRELQQRLEPYADQLRTQVNTQAEQL | Apolipoprotein A-IV | Plasma | 3538.8128 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2640 | KLVPFATELHERLAKDSEKLKEEIGKELEEL | Apolipoprotein A-IV | Plasma | 3620.9665 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2641 | IGDNLRELQQRLEPYADQLRTQVNTQAEQLR | Apolipoprotein A-IV | Plasma | 3694.9139 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2642 | SLAPYAQDTQEKLNHQLEGLTFQMKKNAEELK | Apolipoprotein A-IV | Plasma | 3701.8723 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2643 | AKIDQNVEELKGRLTPYADEFKVKIDQTVEEL | Apolipoprotein A-IV | Plasma | 3717.9465 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2644 | SLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKA | Apolipoprotein A-IV | Plasma | 3772.9094 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2645 | EAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Plasma | 3828.917 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID2646 | AKIDQNVEELKGRLTPYADEFKVKIDQTVEELR | Apolipoprotein A-IV | Plasma | 3874.0476 | LC-MS | Normal | NA | 21136997 |
| CancerPDF_ID3261 | NA | Amyloid beta a4 protein | Serum | 4088 | MALDI-TOF | Stomach adenocarcinoma | NA | 21267442 |
| CancerPDF_ID4099 | ACAEGCQAIVDTGTSLLTGPTSPI | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4806 | FDNIWNQGLVSQDLF | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4807 | FDNIWNQGLVSQDLFSV | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4815 | FDTGSSNLWVPSVY | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID4865 | FGLSETEPGSFLYYAPFDGI | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5218 | GLSETEPGSFLYYAPFDGI | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5219 | GLSETEPGSFLYYAPFDGILGL | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5220 | GLSETEPGSFLYYAPFDGILGLAYPS | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5233 | GNYDAAQRGPGGVW | Serum amyloid A-4 protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5324 | GVGDMGRAYWD | Serum amyloid A-4 protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID5498 | ILQSEGSCISGFQG | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6241 | MWDYFSQLSNNA | Apolipoprotein A-IV | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6242 | MWDYFSQLSNNAKEA | Apolipoprotein A-IV | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6284 | NGVQYPVPPSAYILQSEGSCI | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6807 | SETEPGSFLYYAPFDGILGL | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID6952 | SITYGTGSMTGILGYDTV | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7332 | SYYTGSLNWVPV | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7582 | TVFDRANNQVGLAPVA | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID7765 | VDTGTSLLTGPTSPI | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8175 | WQITVDSITMNG | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8198 | WVPVTVEGY | Pepsin A | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8240 | YDAAQRGPGGVW | Serum amyloid A-4 protein | Urine | NA | Nano-LC-MS | Ovarian cancer | Uniquely present in case of urine of ovarian cancer patients | 24982608 |
| CancerPDF_ID8581 | ISASAEELRQRLAPLAEDVRGNL | Aplipoprotein A-IV | Serum | 2507.35 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8582 | GNTEGLQKSLAELGGHLDQQVEEFR | Aplipoprotein A-IV | Serum | 2754.36 | MALDI-TOF | "Breast cancer, Lung cancer, Rectal cancer" | NA | 23667664 |
| CancerPDF_ID8698 | ALFQDKLGEVNTYAGDLQ | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8750 | DKLGEVNTYA | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8751 | DKLGEVNTYAGDL | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8752 | DKLGEVNTYAGDLQ | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8755 | DKTLSLPELEQ | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8839 | FQDKLGEVNTYA | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID8840 | FQDKLGEVNTYAGDL | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9151 | QDKLGEVNTYA | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9152 | QDKTLSLPELEQ | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9171 | QKIGDNLREL | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9172 | QKIGDNLRELQ | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9190 | QRLEPYADQLR | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9241 | SLAELGGHLDQQVEE | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9308 | TLSLPELEQ | Apolipoprotein A-IV | Ascites fluid | NA | LTQ-Orbitrap XL | Ovarian cancer | Uniquely expressed in ovarian cancer patient | 24694173 |
| CancerPDF_ID9554 | HLDQQVEEF | Apolipoprotein A-IV | Serum | 572.77 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9555 | GGHLDQQVEEF | Apolipoprotein A-IV | Serum | 629.77 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9556 | ELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 750.85 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9557 | AELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 786.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9558 | SLAPYAQDTQEKLN | Apolipoprotein A-IV | Serum | 789.39 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9559 | SLAELGGHLDQQVEE | Apolipoprotein A-IV | Serum | 812.89 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9560 | LAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 842.91 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9561 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 886.42 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9562 | EELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 610.66 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9563 | GNTEGLQKSLAELGGHLD | Apolipoprotein A-IV | Serum | 613.65 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9564 | SLAPYAQDTQEKLNHQ | Apolipoprotein A-IV | Serum | 614.97 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9565 | AEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 634.32 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9566 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 643.32 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9567 | NAEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 672.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9568 | QMKKNAEELKARISASAEELRQ | Apolipoprotein A-IV | Serum | 633.34 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9569 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 867.1 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9570 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 689.6 | LC-MS | Lung adenocarcinoma | Differentially expressed between Lung cancer vs control | 21533267 |
| CancerPDF_ID9571 | LAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 634.35 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID9572 | GNTEGLQKSLAELGGHLDQQVEEFRR | Apolipoprotein A-IV | Serum | 728.62 | LC-MS | Lung adenocarcinoma | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" | 21533267 |
| CancerPDF_ID11187 | AATGRLLLL | Amyloid-like protein 2 (Fragment) | Serum | 926.5913 | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11212 | AETGKPVTL | Cytochrome P450 3A4 | Serum | 914.5073 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11523 | GTHSHGLFK | Cytochrome P450 3A4 | Serum | 982.49846 | LC-MS | Melanoma | "Present in 3 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11601 | HSSSVSQTF | Transcription factor GATA-4 | Serum | 978.44067 | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11725 | KATEKILKM | GTPase IMAP family member 4 | Serum | 1060.6315 | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID11768 | KLAEQEAHY | GTPase IMAP family member 4 | Serum | NA | LC-MS | Melanoma | "Present in 1 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12043 | REAETGKPVTL | Cytochrome P450 3A4 | Serum | 1199.651 | LC-MS | Melanoma | "Present in 2 cancer samples out of 8 cancer samples. ,Present in 0 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12656 | KLPGGSYMAK | "HLA class II histocompatibility antigen, DR beta 5 chain" | Serum | NA | LC-MS | Melanoma | "Present in 4 cancer samples out of 8 cancer samples. ,Present in 1 healthy samples out of 4 healthy samples." | 26992070 |
| CancerPDF_ID12680 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | NA | LC-MS | Renal cell carcinaoma | Upregulated in cancer v/s Normal | 25168216 |
| CancerPDF_ID13368 | FPEPNPRVIEL | Integrin alpha-4 | Plasma | 1310.711 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |
| CancerPDF_ID13491 | ALAIKVLNK | Proteasome subunit alpha type-4 | Plasma | 969.646 | ?LC-MS | "Multiple myeloma patients, Acute myeloid leukemia" | NA | 20974924 |