|
| Primary information |
|---|
| ID | 16302 |
| Therapeutic ID | Th1812 |
| Protein Name | Omburtamab |
| Sequence | >Th1812_Omburtamab
QVQLQQSGAELVKPGASVKLSCKASGYTFTNYDINWVRQRPEQGLEWIGWIFPGDGSTQYNEKFKGKATLTTDTSSSTAYMQLSRLTSEDSAVYFCARQTTATWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | CD276 (B7-H3) is a B7/CD28 immunoglobulin superfamily member frequently expressed among solid human tumours.[A242487, A242492] Omburtamab, formerly the murine anti-B7-H3 antibody 8H9, and its humanized forms are currently under clinical development for use in various cancers.[A191829] Omburtamab is under investigation in clinical trial NCT03275402 (131i-omburtamab Radioimmunotherapy for Neuroblastoma Central Nervous System/leptomeningeal Metastases). |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | CD276 (also known as B7-H3) is a member of the B7/CD28 immunoglobulin superfamily with possible co-stimulatory and co-inhibitory roles in T cell-mediated immunity.[A242487] Despite low to absent expression on most healthy cells, CD276 is frequently highly expressed among solid human tumours.[A242487, A242492] Omburtamab, a murine anti-B7-H3 antibody, and its humanized forms bind to the CD276 FG loop thought to be important in co-inhibitory functions.[A242487, A191829] Omburtamab also facilitates direct antibody-directed cellular cytotoxicity (ADCC) of CD276-expressing tumour cells.[A242487] Recent experiments using chimeric antigen receptor (CAR) T cells and bispecific killer cell engager (BiKE)-redirected natural killer cells demonstrated efficacy against NSCLC _in vitro_ and _in vivo_.[A242492] Hence, targeting CD276 appears to be an appealing option for overcoming immunotherapy blockade in solid tumours. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | CD276 antigen |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |