|
| Primary information |
|---|
| ID | 16232 |
| Therapeutic ID | Th1745 |
| Protein Name | TRX1 |
| Sequence | >Th1745_TRX1
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | TRX1 is a humanized antibody that binds to the CD4 receptor found on a subset of T cells. TRX1 is being developed for the potential treatment of autoimmune diseases in collaboration with Genentech, Inc. TolerRx is currently conducting a Phase I clinical study of TRX1 in the United Kingdom. |
| Indication/Disease | Investigated for use/treatment in autoimmune diseases. |
| Pharmacodynamics | NA |
| Mechanism of Action | TRX1 induces and maintains immunological tolerance and reprogram the immune system to treat patients with immune-related diseases. In preclinical studies, TRX1 therapy has been shown to induce long-term, antigen-specific tolerance without compromising normal immune function. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |