|
| Primary information |
|---|
| ID | 16217 |
| Therapeutic ID | Th1730 |
| Protein Name | CYT007-TNFQb |
| Sequence | >Th1730_CYT007-TNFQb
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | CYT007-TNFQb is an active immunization therapy that aims at providing a novel treatment to people suffering from RA or psoriasis. The vaccine should allow for administration of low amounts of drug to individual patients (in the microgram range) and for convenient dosing schedules. |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders. |
| Pharmacodynamics | NA |
| Mechanism of Action | CYT007-TNFQb is designed to instruct the patient’s immune system to produce an anti-TNF-a antibody response. The induced antibodies aim to bind and neutrolize soluble TNF-a in order to inhibit its inflammatory activity. That way, the subsequent inflammatory process should be slowed down and the deterioration of skin or other tissues reduced. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |