Primary information |
---|
ID | 16178 |
Therapeutic ID | Th1691 |
Protein Name | CG7870 |
Sequence | >Th1691_CG7870
MWTCLCQLCFYLLSTLAVAALSIAALVLYKTKPYPNIKRHKDEETFLDPHTIKTVTFPSLEDSPSLELSVIVPAYNEEQRLPSMLDECLAFLEQKSAGTPNFTYEVIVVSDGSQDATVSVALGYSKKHGAEKVRVLELIENRGKGGAVRMGMLSARGRNLLFADADGATKFPDYDKLEVALKQLAPEWRDDGIAIGSRAHLENDAIATRSFFRTILMHGFHFLVWLFAVRSIRDTQCGFKLFTRTTARKLFTSLHVERWAFDVELLYLAENLKLPMSEVAVRWTEIDGSKLTPFWSWLQMGRDLFMIWVRYLVGAWRIASIQKKEK
|
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | CG7870 is an oncolytic virus therapy for prostate cancer. It is a replication-selective, prostate-specific antigen-targeted oncolytic adenovirus, for the treatment of hormone-refractory, metastatic prostate cancer. |
Indication/Disease | Intended for the treatment of various forms of cancer. |
Pharmacodynamics | NA |
Mechanism of Action | CG7870 is genetically engineered to replicate preferentially in prostate tissue, ignoring healthy cells. In this manner, the virus is able to selectively attack and kill tumorous cells. |
Toxicity | NA |
Metabolism | NA |
Absorption | NA |
| NA |
Clearance | NA |
Categories | NA |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | NA |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | NA |
Remarks | NA |