Detailed description page of ThPDB2
This page displays user query in tabular form. |
Th1658 details |
Primary information | |
---|---|
ID | 15972 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Amino Acids, Peptides, and Proteins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Casirivimab and Imdevimab |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intravenous |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, severe dizziness, rash, and itching |
Route of Administration | Regen-Cov is a prescription medicine used to treat the symptoms of COVID-19 (EUA). Regen-Cov may be used alone or with other medications. |
Recommended Dosage | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, severe dizziness, rash, and itching |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15973 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Antibodies |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Casirivimab With Imdevimab |
Company | Regeneron Pharmaceuticals, Inc. |
Brand Description | Regeneron Pharmaceuticals, Inc. |
Prescribed For | Intravenous |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, severe dizziness, rash, and itching |
Route of Administration | Regen-Cov is a prescription medicine used to treat the symptoms of COVID-19 (EUA). Regen-Cov may be used alone or with other medications. |
Recommended Dosage | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, severe dizziness, rash, and itching |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15974 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Antibodies, Monoclonal |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Imdevimab |
Company | Regeneron Pharmaceuticals, Inc. |
Brand Description | Regeneron Pharmaceuticals, Inc. |
Prescribed For | Intravenous |
Chemical Name | 300 mg/2.5mL |
Formulation | NA |
Physical Appearance | use in treating conditions caused by coronavirus. |
Route of Administration | Imdevimab is an experimental medicine being studied for use in treating conditions caused by coronavirus. It is not yet known if imdevimab is a safe and effective treatment for any condition. |
Recommended Dosage | throat irritation, swelling in your face or throat; dizziness, a light-headed feeling (like you might pass out); chest pain, wheezing, shortness of breath; fever, chills, sweating, nausea, flushing (sudden warmth, redness, or tingly feeling); fast or slow heartbeats, headache, pounding in your neck or ears; weakness, tiredness; rash, itching; or muscle pain. |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15975 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Approved Treatments for COVID-19 |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Imdevimab |
Company | Regeneron Pharmaceuticals, Inc. |
Brand Description | Regeneron Pharmaceuticals, Inc. |
Prescribed For | Intravenous |
Chemical Name | 1332 mg/11.1mL |
Formulation | NA |
Physical Appearance | use in treating conditions caused by coronavirus. |
Route of Administration | Imdevimab is an experimental medicine being studied for use in treating conditions caused by coronavirus. It is not yet known if imdevimab is a safe and effective treatment for any condition. |
Recommended Dosage | throat irritation, swelling in your face or throat; dizziness, a light-headed feeling (like you might pass out); chest pain, wheezing, shortness of breath; fever, chills, sweating, nausea, flushing (sudden warmth, redness, or tingly feeling); fast or slow heartbeats, headache, pounding in your neck or ears; weakness, tiredness; rash, itching; or muscle pain. |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15976 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Blood Proteins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Regen-cov |
Company | Regeneron Pharmaceuticals, Inc. |
Brand Description | Regeneron Pharmaceuticals, Inc. |
Prescribed For | Intravenous |
Chemical Name | NA |
Formulation | None. |
Physical Appearance | infusion-related reactions (hives, itching, flushing, fever, shortness of breath, chest tightness, nausea, vomiting, rash) and severe allergic reactions (anaphylaxis). |
Route of Administration | NA |
Recommended Dosage | Regen-Cov is a prescription medicine used to treat the symptoms of COVID-19 (EUA). Regen-Cov may be used alone or with other medications. |
Contraindication | NA |
Side Effects | Casirivimab, a human immunoglobulin G-1 (IgG1) monoclonal antibody (mAb), is a covalent heterotetramer consisting of 2 heavy chains and 2 light chains produced by recombinant DNA technology in Chinese hamster ovary (CHO) cell suspension culture and has an approximate molecular weight of 145.23 kDa. |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15977 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Immunoglobulins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Regen-cov |
Company | Regeneron Pharmaceuticals, Inc. |
Brand Description | Regeneron Pharmaceuticals, Inc. |
Prescribed For | Intravenous |
Chemical Name | NA |
Formulation | None. |
Physical Appearance | infusion-related reactions (hives, itching, flushing, fever, shortness of breath, chest tightness, nausea, vomiting, rash) and severe allergic reactions (anaphylaxis). |
Route of Administration | NA |
Recommended Dosage | Regen-Cov is a prescription medicine used to treat the symptoms of COVID-19 (EUA). Regen-Cov may be used alone or with other medications. |
Contraindication | NA |
Side Effects | Casirivimab, a human immunoglobulin G-1 (IgG1) monoclonal antibody (mAb), is a covalent heterotetramer consisting of 2 heavy chains and 2 light chains produced by recombinant DNA technology in Chinese hamster ovary (CHO) cell suspension culture and has an approximate molecular weight of 145.23 kDa. |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15978 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Immunoproteins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | Ronapreve |
Company | Roche Registration Gmb H |
Brand Description | Roche Registration Gmb H |
Prescribed For | Intravenous; Subcutaneous |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | The most common side effects with Ronapreve (which may affect up to 1 in 10 people) are allergic reactions, which include infusion related reactions and injection site reactions. |
Route of Administration | Ronapreve was found to be effective at preventing people from getting infected and developing symptoms after contact: amongst people who tested negative for SARS-CoV-2 following contact, fewer people given Ronapreve developed symptoms within 29 days of their test results compared with people given placebo (1.5% (11 out of 753) for Ronapreve compared with 7.8% (59 out of 752 people) for placebo). |
Recommended Dosage | Ronapreve is a medicine used for treating COVID-19 in adults and adolescents (from 12 years of age and weighing at least 40 kilograms) who do not require supplemental oxygen and who are at increased risk of their disease becoming severe. |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 15979 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Proteins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | NA |
Remarks | NA |
Primary information | |
---|---|
ID | 15980 |
Therapeutic ID | Th1658 |
Protein Name | Imdevimab |
Sequence | >Th1658_Imdevimab QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Imdevimab is a monoclonal antibody combined with [casirivimab] in Regeneron's antibody cocktail known as REGEN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21, 2020, the FDA authorized emergency approval of REGN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data on imdevimab are not yet available, and further evaluation of this investigational therapy will continue.[L23529,L23539,L14303] |
Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23534,L23539] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
Mechanism of Action | Imdevimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the target cell by binding to the ACE2 receptor.[A224424,A224434,L23529] Together with casirivimab, imdevimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for imdevimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
Metabolism | NA |
Absorption | NA |
NA | |
Clearance | NA |
Categories | Serum Globulins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Spike glycoprotein |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | NA |
Remarks | NA |