Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1657 details

Primary information
ID	15964
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Amino Acids, Peptides, and Proteins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	Inmazeb
Company	Regeneron Pharmaceuticals, Inc.
Brand Description	Regeneron Pharmaceuticals, Inc.
Prescribed For	Intravenous
Chemical Name	NA
Formulation	None.
Physical Appearance	fever, chills, fast heart rate, fast, shallow breathing, vomiting, low blood pressure (hypotension), diarrhea, and low blood oxygen (hypoxia)
Route of Administration	Atoltivimab, maftivimab, and odesivimab-ebgn combination injection is used to treat infection cause by Zaire ebolavirus. This medicine is to be given only by or under the direct supervision of your doctor. Before using Inmazeb In deciding to use a medicine, the risks of taking the medicine must be weighed...
Recommended Dosage	Inmazeb (atoltivimab, maftivimab, and odesivimab-ebgn) is a combination of Zaire ebolavirus glycoprotein-directed human monoclonal antibodies used to treat infection caused by Zaire ebolavirus in adult and pediatric patients, including neonates born to a mother who is RT-PCR positive for Zaire ebolavirus infection.
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	15965
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Antibodies, Monoclonal
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15966
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Antibodies, Monoclonal, Humanized
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15967
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Blood Proteins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15968
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Immunoglobulins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15969
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Proteins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15970
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Serum Globulins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15971
Therapeutic ID	Th1657
Protein Name	Odesivimab
Sequence	>Th1657_Odesivimab EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDMHWVRQATGKGLEWVSAIGTAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARTWFGELYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight	146164.54
Chemical Formula	C6506H10024N1720O2030S42
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	Odesivimab administered to healthy subjects at 50 mg/kg has a mean elimination half-life of 25.3 ± 3.86 days.[L17320]
Description	Ebola virus (EBOV) remains an important human pathogen within the _Ebolavirus_ genus, having been responsible for at least 17 known outbreaks with an average case fatality rate of 43.92%.[A221825] Immune therapy using monoclonal antibodies (mAbs) is becoming an increasingly attractive therapeutic method to combat infectious diseases due to its rapid development, low toxicity, and high specificity.[A222078] The chief surface target of EBOV particles is the GP_1,2 glycoprotein, which also appears on the surface of EBOV-infected cells, offering opportunities for both neutralizing and cytotoxic (i.e. through Fc-mediated immune effector function) antibody effects to play a role in combatting EBOV infection.[A221825, A221830] A recent large-scale study elucidated that both neutralizing and Fc-mediated functions of antibodies were important for therapeutic benefit in animal models of EBOV infection.[A222078] INMAZEB™, formerly referred to as REGN-EB3, combines the three humanized IgG1 mAbs Odesivimab (REGN 3471), [Maftivimab] (REGN 3479), and [Atoltivimab] (REGN 3470) in equimolar proportions. All three mAbs bind to a distinct portion of the GP_1,2 glycoprotein and collectively provide neutralizing and Fc-mediated immune effector function against EBOV _in vitro_ and protection against EBOV infection _in vivo_. INMAZEB™ is produced by Regeneron Pharmaceuticals and was granted FDA approval on October 14, 2020.[L17320]
Indication/Disease	Odesivimab is indicated in combination with [Maftivimab] and [Atoltivimab] for the treatment of _Zaire ebolavirus_ infection in adult and pediatric patients, including neonates born to a mother who has been confirmed positive by RT-PCR for _Zaire ebolavirus_ infection. This combination has not been established as efficacious for any other species within either the _Ebolavirus_ or _Marburgvirus_ genera; special care should be taken to evaluate the susceptibility of circulating _Zaire ebolavirus_ strains before beginning treatment, and the possible emergence of resistance should be monitored.[L17320]
Pharmacodynamics	Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the GP_1,2 glycoprotein that provides both neutralizing and Fc-dependent immune-mediated activity against _Zaire ebolavirus_. As a mAb, Odesivimab exhibits low toxicity and is generally well tolerated but does include the risk of potentially life-threatening hypersensitivity reactions.[L17320]
Mechanism of Action	Ebola virus (EBOV) is one of several viruses within the _Ebolavirus_ genus known to infect humans with an average case fatality rate of 43.92%.[A221825] EBOV particles expose the GP_1,2 glycoprotein on their surface, which comprises a trimer of GP₁ and GP₂ subunit heterodimers, with the subunits connected by a disulfide bond. GP_1,2 plays an important role in both cell surface attachment/entry and eventual lysosomal escape through binding to the NPC intracellular cholesterol transporter 1/Niemann-Pick C1 protein (NPC1). In this manner, GP_1,2 is integral to the pathogenic cycle of EBOV.[A221825, A221830] Odesivimab is a fully-humanized IgG1 monoclonal antibody (mAb) directed against the EBOV GP_1,2 glycoprotein, which binds within the "chalice" structure near the GP head in partial contact with the glycan cap with a binding affinity (_K_D_) of between 8.26 and 8.42 nM.[A221830, L17320] Odesivimab exhibits weak (<50%) neutralization of chimeric lentiviral particles expressing EBOV GP_1,2 and is able to bind soluble GP_1,2. In addition, Odesivimab is capable of dose-dependent activation of FcRIIIa signalling in effector cells in the presence of GP_1,2-expressing cells with a half-maximal effective concentration (EC₅₀) of 1.6 nM.[A221830] Combined with [Maftivimab] and [Atoltivimab], Odesivimab works to block EBOV cell infection and lysosomal escape, as well as the potential antibody-dependent cell-mediated killing of EBOV-infected cells.[A221825, A221830, A222078, L17320]
Toxicity	NA
Metabolism	NA
Absorption	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean C_max of 1260 ± 81.2 mg/L and a mean AUC_0-8 of 25,600 ± 5040 mg
	Odesivimab administered to healthy subjects at 50 mg/kg produced a mean steady-state volume of distribution of 56.0 ± 3.16 mL/kg.[L17320]
Clearance	Odesivimab administered to healthy subjects at 50 mg/kg has a mean clearance of 2.02 ± 0.374 mL/day/kg.[L17320]
Categories	Treatments for Ebola Virus Disease
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Envelope glycoprotein
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA