Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1641 details |
| Primary information | |
|---|---|
| ID | 15903 |
| Therapeutic ID | Th1641 |
| Protein Name | Trefoil Factor 2 |
| Sequence | >Th1641_Trefoil_Factor_2 MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | The trefoil factor 2 (TFF2) peptide is a low-molecular weight protein and one of the three trefoil-motif-containing proteins. They are expressed predominantly in gastric tissues with the source for them being predominantly stromal cells, although expression of TFF2 mRNA transcripts also occurs with tissue macrophages. The peptides themselves are most abundant in mucous cells of the gastric mucosa with TFF2 being detected in mucous layers over the tissue. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | TFF2 acts as a regulator of mucosal tissue repair and is a part of epithelial defences, promoting restitution. TFF2 is upregulated in gastric tissue with Helicobacter infections and gastric tissues with inflammatory conditions; its anti-inflammatory actions allow it to down-regulate gastric and colonic inflammation. It has also been proposed that TFF2 is involved with some aspect of immune function. Although there are reports of a number of potential biological roles for TFF, currently, the exact mechanism of action is yet to be elucidated as cell surface receptors for TFFs have not yet been identified. However, a study proposes TFF2 to have a role in the negative regulation of interleukin 1 (IL-1) receptor-mediated signalling. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15904 |
| Therapeutic ID | Th1641 |
| Protein Name | Trefoil Factor 2 |
| Sequence | >Th1641_Trefoil_Factor_2 MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | The trefoil factor 2 (TFF2) peptide is a low-molecular weight protein and one of the three trefoil-motif-containing proteins. They are expressed predominantly in gastric tissues with the source for them being predominantly stromal cells, although expression of TFF2 mRNA transcripts also occurs with tissue macrophages. The peptides themselves are most abundant in mucous cells of the gastric mucosa with TFF2 being detected in mucous layers over the tissue. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | TFF2 acts as a regulator of mucosal tissue repair and is a part of epithelial defences, promoting restitution. TFF2 is upregulated in gastric tissue with Helicobacter infections and gastric tissues with inflammatory conditions; its anti-inflammatory actions allow it to down-regulate gastric and colonic inflammation. It has also been proposed that TFF2 is involved with some aspect of immune function. Although there are reports of a number of potential biological roles for TFF, currently, the exact mechanism of action is yet to be elucidated as cell surface receptors for TFFs have not yet been identified. However, a study proposes TFF2 to have a role in the negative regulation of interleukin 1 (IL-1) receptor-mediated signalling. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Peptides |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15905 |
| Therapeutic ID | Th1641 |
| Protein Name | Trefoil Factor 2 |
| Sequence | >Th1641_Trefoil_Factor_2 MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | The trefoil factor 2 (TFF2) peptide is a low-molecular weight protein and one of the three trefoil-motif-containing proteins. They are expressed predominantly in gastric tissues with the source for them being predominantly stromal cells, although expression of TFF2 mRNA transcripts also occurs with tissue macrophages. The peptides themselves are most abundant in mucous cells of the gastric mucosa with TFF2 being detected in mucous layers over the tissue. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | TFF2 acts as a regulator of mucosal tissue repair and is a part of epithelial defences, promoting restitution. TFF2 is upregulated in gastric tissue with Helicobacter infections and gastric tissues with inflammatory conditions; its anti-inflammatory actions allow it to down-regulate gastric and colonic inflammation. It has also been proposed that TFF2 is involved with some aspect of immune function. Although there are reports of a number of potential biological roles for TFF, currently, the exact mechanism of action is yet to be elucidated as cell surface receptors for TFFs have not yet been identified. However, a study proposes TFF2 to have a role in the negative regulation of interleukin 1 (IL-1) receptor-mediated signalling. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Trefoil Factors |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |