Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1640 details

Primary information
ID	15896
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Amino Acids, Peptides, and Proteins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15897
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Biological Factors
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15898
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Cytokines
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15899
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Intercellular Signaling Peptides and Proteins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15900
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Interferons
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15901
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Peptides
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA

Primary information
ID	15902
Therapeutic ID	Th1640
Protein Name	Interferon Kappa
Sequence	>Th1640_Interferon_Kappa MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Molecular Weight	NA
Chemical Formula	NA
Isoelectric Point	NA
Hydrophobicity	NA
Melting point	NA
Half-life	NA
Description	Interferon kappa is a subclass of type I interferon mediating host defence which consists of 207 amino acids and has 30% homology with others of the same class as it consists of a series of cysteine and a 27-amino acid signal peptide conserved in type I interferons. This gene encoding for this interferon is expressed in human epidermal keratinocytes.
Indication/Disease	NA
Pharmacodynamics	NA
Mechanism of Action	Significant interferon kappa expression enhancement occurs with: viral infection, exposure to double-stranded RNA, or treatment with interferon gamma or interferon beta. It was also found cellular protection against viral infection occurs in a species-specific manner. The mechanism by which IFN- acts involves the activation of the interferon-stimulated response element signalling pathway and a panel of genes which include anti-viral mediators and transcriptional regulators, similar to those regulated by other type I interferons. Also as with other type I interferons, IFN- binds at the same receptors, which are interferon-a/ß receptor 1(IFNAR1) and IFNAR2.
Toxicity	NA
Metabolism	NA
Absorption	NA
	NA
Clearance	NA
Categories	Proteins
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	NA
Brand Name	NA
Company	NA
Brand Description	NA
Prescribed For	NA
Chemical Name	NA
Formulation	NA
Physical Appearance	NA
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	NA
Remarks	NA