Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1617 details
Primary information
ID15665
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesAmino Acids, Peptides, and Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameBeovu
CompanyNovartis
Brand DescriptionNovartis
Prescribed ForIntravitreal
Chemical Name6 mg / 0.05 mL
FormulationOcular Or Periocular Infections BEOVU is contraindicated in patients with ocular or periocular infections. Active Intraocular Inflammation BEOVU is contraindicated in patients with active intraocular inflammation. Hypersensitivity BEOVU is contraindicated in patients with known hypersensitivity to brolucizumab or any of the excipients in BEOVU. Hypersensitivity reactions may manifest as rash, pruritus, urticaria, erythema, or severe intraocular inflammation.
Physical Appearance blurred vision, cataracts, bleeding in the eye, eye pain, and eye "floaters"
Route of AdministrationBeovu (brolucizumab-dbll) injection is a biological drug that is used to treat two chronic eye conditions. One is called neovascular (wet) age-related macular degeneration (AMD) and it is a leading cause of vision loss in people 50 years of age and over. The other is called diabetic macular edema (DME)....
Recommended DosageBeovu is a prescription medicine used to treat the symptoms of Macular Degeneration. Beovu may be used alone or with other medications.
ContraindicationNA
Side EffectsBrolucizumab-dbll is a recombinant human vascular endothelial growth factor inhibitor. Brolucizumab-dbll is a humanized monoclonal single-chain Fv (scFv) antibody fragment. Brolucizumab-dbll has a molecular weight of ~26 kilodaltons and is produced in Escherichia coli cells by recombinant DNA technology.
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID15666
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesAngiogenesis Inhibitors
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameBeovu
CompanyNovartis Pharmaceuticals Corporation
Brand DescriptionNovartis Pharmaceuticals Corporation
Prescribed ForIntravitreal
Chemical Name6 mg/0.05mL
FormulationOcular Or Periocular Infections BEOVU is contraindicated in patients with ocular or periocular infections. Active Intraocular Inflammation BEOVU is contraindicated in patients with active intraocular inflammation. Hypersensitivity BEOVU is contraindicated in patients with known hypersensitivity to brolucizumab or any of the excipients in BEOVU. Hypersensitivity reactions may manifest as rash, pruritus, urticaria, erythema, or severe intraocular inflammation.
Physical Appearance blurred vision, cataracts, bleeding in the eye, eye pain, and eye "floaters"
Route of AdministrationBeovu (brolucizumab-dbll) injection is a biological drug that is used to treat two chronic eye conditions. One is called neovascular (wet) age-related macular degeneration (AMD) and it is a leading cause of vision loss in people 50 years of age and over. The other is called diabetic macular edema (DME)....
Recommended DosageBeovu is a prescription medicine used to treat the symptoms of Macular Degeneration. Beovu may be used alone or with other medications.
ContraindicationNA
Side EffectsBrolucizumab-dbll is a recombinant human vascular endothelial growth factor inhibitor. Brolucizumab-dbll is a humanized monoclonal single-chain Fv (scFv) antibody fragment. Brolucizumab-dbll has a molecular weight of ~26 kilodaltons and is produced in Escherichia coli cells by recombinant DNA technology.
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID15667
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesAntibodies
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameBeovu
CompanyNovartis Europharm Limited
Brand DescriptionNovartis Europharm Limited
Prescribed ForIntravitreal
Chemical Name120 mg/ml
FormulationOcular Or Periocular Infections BEOVU is contraindicated in patients with ocular or periocular infections. Active Intraocular Inflammation BEOVU is contraindicated in patients with active intraocular inflammation. Hypersensitivity BEOVU is contraindicated in patients with known hypersensitivity to brolucizumab or any of the excipients in BEOVU. Hypersensitivity reactions may manifest as rash, pruritus, urticaria, erythema, or severe intraocular inflammation.
Physical Appearance blurred vision, cataracts, bleeding in the eye, eye pain, and eye "floaters"
Route of AdministrationBeovu (brolucizumab-dbll) injection is a biological drug that is used to treat two chronic eye conditions. One is called neovascular (wet) age-related macular degeneration (AMD) and it is a leading cause of vision loss in people 50 years of age and over. The other is called diabetic macular edema (DME)....
Recommended DosageBeovu is a prescription medicine used to treat the symptoms of Macular Degeneration. Beovu may be used alone or with other medications.
ContraindicationNA
Side EffectsBrolucizumab-dbll is a recombinant human vascular endothelial growth factor inhibitor. Brolucizumab-dbll is a humanized monoclonal single-chain Fv (scFv) antibody fragment. Brolucizumab-dbll has a molecular weight of ~26 kilodaltons and is produced in Escherichia coli cells by recombinant DNA technology.
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID15668
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesAntibodies, Monoclonal
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15669
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesAntibodies, Monoclonal, Humanized
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15670
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesAntineovascularisation Agents
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15671
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesBlood Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15672
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesEENT Drugs, Miscellaneous
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15673
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesGlobulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15674
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesImmunoglobulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15675
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesImmunoproteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15676
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesOcular Vascular Disorder Agents
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15677
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesOphthalmologicals
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15678
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesProteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15679
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesSensory Organs
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15680
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesSerum Globulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID15681
Therapeutic IDTh1617
Protein NameBrolucizumab
Sequence>Th1617_Brolucizumab MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
Molecular Weight26000
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104]
DescriptionBrolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089]
Indication/DiseaseBrolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089]
PharmacodynamicsBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089]
Mechanism of ActionBrolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089]
ToxicityData regarding the toxicity of brolucizumab is not readily available.[L9089]
MetabolismMonoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470]
AbsorptionA 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng
Data regarding the volume of distribution is not readily available.[L9089]
ClearanceData regarding the clearance of brolucizumab is not readily available.[L9089]
CategoriesVascular Endothelial Growth Factor Inhibitor
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetVascular endothelial growth factor A
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA