Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1613 details |
| Primary information | |
|---|---|
| ID | 15619 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Humegon Inj 75 I.U. |
| Company | Organon Canada Ltd Ltee |
| Brand Description | Organon Canada Ltd Ltee |
| Prescribed For | Intramuscular |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | Abdominal or stomach pain (severe) bloating (moderate to severe) chest pain or trouble breathing decreased amount of urine feeling of indigestion general feeling of discomfort or illness headache, severe and throbbing nausea, vomiting, or diarrhea (continuing or severe) pain or swelling in the arms or legs pelvic pain (severe) severe cramping of the uterus shortness of breath or wheezing swelling of the lower legs weight gain (rapid) |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15620 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Gonadotropins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Menopur |
| Company | Ferring Pharmaceuticals Inc. |
| Brand Description | Ferring Pharmaceuticals Inc. |
| Prescribed For | Subcutaneous |
| Chemical Name | NA |
| Formulation | MENOPUR® is contraindicated in women who exhibit: Prior hypersensitivity to MENOPUR® or menotropins products or one of their excipients High levels of FSH indicating primary ovarian failure [see INDICATIONS AND USAGE] Pregnancy MENOPUR® may cause fetal harm when administered to a pregnant woman [see Use in Specific Populations]. MENOPUR® is contraindicated in women who are pregnant. If this drug is used during pregnancy, or if the woman becomes pregnant while taking this drug, the woman should be apprised of the potential hazard to a fetus. Presence of uncontrolled non-gonadal endocrinopathies (e.g., thyroid, adrenal, or pituitary disorders) [see INDICATIONS AND USAGE] Sex hormone dependent tumors of the reproductive tract and accessory organs Tumors of pituitary gland or hypothalamus Abnormal uterine bleeding of undetermined origin Ovarian cyst or enlargement of undetermined origin, not due to polycystic ovary syndrome |
| Physical Appearance | headache, drowsiness, stomach or abdominal pain, bloating, injection site reactions (pain, swelling, irritation, redness), breast enlargement or tenderness, dizziness, nausea, vomiting, diarrhea, shortness of breath, pain/warmth/tenderness centralized in an arm or leg, fever, chills, weakness or aching of muscles or joints, or rash. |
| Route of Administration | Menotropins injection is used to treat infertility in women. Menotropins are a mixture of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) that are produced in the body by the pituitary gland. Menotropins injection is used in women with healthy ovaries who are enrolled in a fertility program... |
| Recommended Dosage | Menopur is a prescription medicine used to treat the symptoms of Ovulation Induction, Spermatogenesis and Assisted Reproductive Technology. Menopur may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | MENOPUR® is a preparation of gonadotropins (FSH and LH activity), extracted from the urine of postmenopausal women, which has undergone additional steps for purification. |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15621 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Gonadotropins, Pituitary |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Pergonal 75 I.U. |
| Company | Emd Serono, A Division Of Emd Inc., Canada |
| Brand Description | Emd Serono, A Division Of Emd Inc., Canada |
| Prescribed For | Intramuscular |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | Back pain breast tenderness feeling of warmth, redness of the face, neck, arms, and occasionally, upper chest menstrual changes muscle aches and pains unusual tiredness or weakness |
| Route of Administration | Menotropins injection is used in women with healthy ovaries who are enrolled in a fertility program called assisted reproductive technology (ART). ART uses procedures such as in vitro fertilization (IVF). Menotropins is used together with human chorionic gonadotropin (hCG) in these procedures. |
| Recommended Dosage | Menotropins injection is used to treat infertility in women. Menotropins are a mixture of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) that are produced in the body by the pituitary gland. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15622 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Hormones |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Repronex |
| Company | Ferring Pharmaceuticals |
| Brand Description | Ferring Pharmaceuticals |
| Prescribed For | Intramuscular; Subcutaneous |
| Chemical Name | NA |
| Formulation | Repronex® (menotropins for injection) is contraindicated in women who have: A high FSH level indicating primary ovarian failure. Uncontrolled thyroid and adrenal dysfunction. An organic intracranial lesion such as a pituitary tumor. The presence of any cause of infertility other than anovulation unless they are candidates for in vitro-fertilization. Abnormal bleeding of undetermined origin. Ovarian cysts or enlargement not due to polycystic ovary syndrome. Prior hypersensitivity to menotropins. Repronex® (menotropins for injection) is not indicated in women who are pregnant. There are limited human data on the effects of menotropins when administered during pregnancy. |
| Physical Appearance | headache mild stomach pain bloating injection site reactions (redness, pain, swelling, or irritation) breast tenderness or enlargement dizziness ovarian enlargement (abdominal or pelvic pain, tenderness, pressure, or swelling) nausea vomiting diarrhea shortness of breath pain/warmth/tenderness centralized in an arm or leg fever chills drowsiness weakness or aching of muscles or joints, or rash |
| Route of Administration | Menotropins injection is used to treat infertility in women. Menotropins are a mixture of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) that are produced in the body by the pituitary gland. Menotropins injection is used in women with healthy ovaries who are enrolled in a fertility program... |
| Recommended Dosage | Repronex is a prescription medicine used to treat the symptoms of Ovulation Induction, Assisted Reproductive Technology (ART), and Spermatogenesis. Repronex may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | FOR SUBCUTANEOUS INJECTION AND INTRAMUSCULAR INJECTION |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15623 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Hormones, Hormone Substitutes, and Hormone Antagonists |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15624 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Peptide Hormones |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15625 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Peptides |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15626 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Pituitary Hormones |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 15627 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Pituitary Hormones, Anterior |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |