Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1446 details |
| Primary information | |
|---|---|
| ID | 13910 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13911 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Biological Factors |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13912 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Cytokines |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13913 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Intercellular Signaling Peptides and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13914 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Interleukins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13915 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Peptides |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13916 |
| Therapeutic ID | Th1446 |
| Protein Name | Interleukin-7 |
| Sequence | >Th1446_Interleukin-7 MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Interleukin 7 has been used in trials studying the treatment of Metastatic Breast Cancer. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | Interleukin-7 human recombinant is a recombinant format of IL-7, a growth factor for T-cells which is shown to help restore and maintain lymphocyte counts, including both CD4+ and CD8+ T-cells, increasing the numbers of functional T-cells. The exact mechanism of action behind this is currently unknown. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |