Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1403 details |
| Primary information | |
|---|---|
| ID | 13436 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 1000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13437 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Biological Factors |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 2000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13438 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Carbohydrates |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 3000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13439 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Colony-Stimulating Factors |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 4000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13440 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Cytokines |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 10000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13441 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Glycoconjugates |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 5000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13442 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Glycoproteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 6000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13443 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Hematopoietic Cell Growth Factors |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Dynepo |
| Company | Shire Pharmaceutical Contracts Limited |
| Brand Description | Shire Pharmaceutical Contracts Limited |
| Prescribed For | Intravenous; Subcutaneous |
| Chemical Name | 8000 IU |
| Formulation | NA |
| Physical Appearance | The most common side effects are hypertension (raised blood pressure), headache, and, for patients on dialysis, problems with the dialysis tubes |
| Route of Administration | Dynepo is a solution for injection in pre-filled syringe. It is available in strengths from 2,000 IU/ml to 20,000 IU/ml. Dynepo contains the active ingredient epoetin delta. |
| Recommended Dosage | Dynepo is used to treat anaemia (fewer than normal red blood cells in the blood) in adult patients with chronic renal failure (long-term kidney disease). It may be used in patients on dialysis (a blood clearance technique) or not on dialysis. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13444 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Intercellular Signaling Peptides and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13445 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Peptides |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13446 |
| Therapeutic ID | Th1403 |
| Protein Name | Epoetin delta |
| Sequence | >Th1403_Epoetin_delta APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Epoetin Delta is an ingredient in the EMA-withdrawn product Dynepo. |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |