Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1401 details
Primary information
ID13404
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesAmino Acids, Peptides, and Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameHyper Tet
CompanyCutter Med & Biol, Division Of Miles Canada Ltd.
Brand DescriptionCutter Med & Biol, Division Of Miles Canada Ltd.
Prescribed ForIntramuscular
Chemical Name0.165
FormulationNone known.
Physical Appearance hives, difficulty breathing, swelling of your face, lips, tongue, or throat, chest pain or pressure, painful or difficulty urinating, and changes in the amount of urine
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID13405
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesAntiinfectives for Systemic Use
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameHyperTET
CompanyGRIFOLS USA, LLC
Brand DescriptionGRIFOLS USA, LLC
Prescribed ForIntramuscular
Chemical Name250 [iU]/1mL
FormulationNone known.
Physical Appearance hives, difficulty breathing, swelling of your face, lips, tongue, or throat, chest pain or pressure, painful or difficulty urinating, and changes in the amount of urine
Route of AdministrationNA
Recommended DosageHyperTET is a prescription medicine used as a prophylaxis against Tetanus following injury. HyperTET may be used alone or with other medications.
ContraindicationNA
Side EffectsTetanus Immune Globulin (Human) — HyperTET® S/D treated with solvent/detergent is a colorless to pale yellow or pink sterile solution of tetanus hyperimmune immune globulin for intramuscular administration; it is preservative-free, in a latex-free delivery system. HyperTET S/D is prepared by cold ethanol fractionation fromthe plasma of donors immunized with tetanus toxoid. The immune globulin is isolated from solubilized Cohn Fraction II. The Fraction II solution is adjusted to a final concentration of 0.3% tri-n-butyl phosphate (TNBP) and 0.2% sodium cholate. After the addition of solvent (TNBP) and detergent (sodium cholate), the solution is heated to 30°C and maintained at that temperature for not less than 6 hours. After the viral inactivation step, the reactants are removed by precipitation, filtration and finally ultrafiltration and diafiltration. HyperTET S/D is formulated as a 15–18% protein solution at a pH of 6.4–7.2 in 0.21–0.32 M glycine. HyperTET S/D is then incubated in the final container for 21–28 days at 20–27°C. The product is standardized against the U.S. Standard Antitoxin and the U.S. Control Tetanus Toxin and contains not less than 250 tetanus antitoxin units per container.
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID13406
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesBlood Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameHyperTET
CompanyGrifols Therapeutics Llc
Brand DescriptionGrifols Therapeutics Llc
Prescribed ForIntramuscular
Chemical Name250 unit / mL
FormulationNone known.
Physical Appearance hives, difficulty breathing, swelling of your face, lips, tongue, or throat, chest pain or pressure, painful or difficulty urinating, and changes in the amount of urine
Route of AdministrationNA
Recommended DosageHyperTET is a prescription medicine used as a prophylaxis against Tetanus following injury. HyperTET may be used alone or with other medications.
ContraindicationNA
Side EffectsTetanus Immune Globulin (Human) — HyperTET® S/D treated with solvent/detergent is a colorless to pale yellow or pink sterile solution of tetanus hyperimmune immune globulin for intramuscular administration; it is preservative-free, in a latex-free delivery system. HyperTET S/D is prepared by cold ethanol fractionation fromthe plasma of donors immunized with tetanus toxoid. The immune globulin is isolated from solubilized Cohn Fraction II. The Fraction II solution is adjusted to a final concentration of 0.3% tri-n-butyl phosphate (TNBP) and 0.2% sodium cholate. After the addition of solvent (TNBP) and detergent (sodium cholate), the solution is heated to 30°C and maintained at that temperature for not less than 6 hours. After the viral inactivation step, the reactants are removed by precipitation, filtration and finally ultrafiltration and diafiltration. HyperTET S/D is formulated as a 15–18% protein solution at a pH of 6.4–7.2 in 0.21–0.32 M glycine. HyperTET S/D is then incubated in the final container for 21–28 days at 20–27°C. The product is standardized against the U.S. Standard Antitoxin and the U.S. Control Tetanus Toxin and contains not less than 250 tetanus antitoxin units per container.
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID13407
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesImmune Sera and Immunoglobulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameHypertet S/d
CompanyGrifols Therapeutics Llc
Brand DescriptionGrifols Therapeutics Llc
Prescribed ForIntramuscular
Chemical Name250 [iU] /mL
FormulationNone known.
Physical Appearance Slight soreness at the site of injection and slight temperature elevation may be noted at times. Sensitization to repeated injections of human immunoglobulin is extremely rare. In the course of routine injections of large numbers of persons with immunoglobulin there have been a few isolated occurrences of angio neurotic edema, nephrotic syndrome, and anaphylactic shock after injection.
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID13408
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesImmunoglobulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameHypertet S/d
CompanyGrifols Therapeutics Llc
Brand DescriptionGrifols Therapeutics Llc
Prescribed ForIntramuscular
Chemical Name250 unit/1
FormulationNone known.
Physical Appearance Slight soreness at the site of injection and slight temperature elevation may be noted at times. Sensitization to repeated injections of human immunoglobulin is extremely rare. In the course of routine injections of large numbers of persons with immunoglobulin there have been a few isolated occurrences of angio neurotic edema, nephrotic syndrome, and anaphylactic shock after injection.
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID13409
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesProteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID13410
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesSerum
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID13411
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesSerum Globulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID13412
Therapeutic IDTh1401
Protein NameTetanus immune globulin, human
Sequence>Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeHalf life is about 23 days [FDA Label].
DescriptionTetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients.
Indication/DiseaseFor use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus.
PharmacodynamicsHuman clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label].
Mechanism of ActionThe immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells.
ToxicityNo toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label].
MetabolismNA
AbsorptionTmax for intramuscular administration is 2 days [FDA Label].
NA
ClearanceNA
CategoriesSpecific Immunoglobulins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTetanus toxin
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA