Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1401 details |
| Primary information | |
|---|---|
| ID | 13404 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | Hyper Tet |
| Company | Cutter Med & Biol, Division Of Miles Canada Ltd. |
| Brand Description | Cutter Med & Biol, Division Of Miles Canada Ltd. |
| Prescribed For | Intramuscular |
| Chemical Name | 0.165 |
| Formulation | None known. |
| Physical Appearance | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, chest pain or pressure, painful or difficulty urinating, and changes in the amount of urine |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13405 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Antiinfectives for Systemic Use |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | HyperTET |
| Company | GRIFOLS USA, LLC |
| Brand Description | GRIFOLS USA, LLC |
| Prescribed For | Intramuscular |
| Chemical Name | 250 [iU]/1mL |
| Formulation | None known. |
| Physical Appearance | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, chest pain or pressure, painful or difficulty urinating, and changes in the amount of urine |
| Route of Administration | NA |
| Recommended Dosage | HyperTET is a prescription medicine used as a prophylaxis against Tetanus following injury. HyperTET may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | Tetanus Immune Globulin (Human) — HyperTET® S/D treated with solvent/detergent is a colorless to pale yellow or pink sterile solution of tetanus hyperimmune immune globulin for intramuscular administration; it is preservative-free, in a latex-free delivery system. HyperTET S/D is prepared by cold ethanol fractionation fromthe plasma of donors immunized with tetanus toxoid. The immune globulin is isolated from solubilized Cohn Fraction II. The Fraction II solution is adjusted to a final concentration of 0.3% tri-n-butyl phosphate (TNBP) and 0.2% sodium cholate. After the addition of solvent (TNBP) and detergent (sodium cholate), the solution is heated to 30°C and maintained at that temperature for not less than 6 hours. After the viral inactivation step, the reactants are removed by precipitation, filtration and finally ultrafiltration and diafiltration. HyperTET S/D is formulated as a 15–18% protein solution at a pH of 6.4–7.2 in 0.21–0.32 M glycine. HyperTET S/D is then incubated in the final container for 21–28 days at 20–27°C. The product is standardized against the U.S. Standard Antitoxin and the U.S. Control Tetanus Toxin and contains not less than 250 tetanus antitoxin units per container. |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13406 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Blood Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | HyperTET |
| Company | Grifols Therapeutics Llc |
| Brand Description | Grifols Therapeutics Llc |
| Prescribed For | Intramuscular |
| Chemical Name | 250 unit / mL |
| Formulation | None known. |
| Physical Appearance | hives, difficulty breathing, swelling of your face, lips, tongue, or throat, chest pain or pressure, painful or difficulty urinating, and changes in the amount of urine |
| Route of Administration | NA |
| Recommended Dosage | HyperTET is a prescription medicine used as a prophylaxis against Tetanus following injury. HyperTET may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | Tetanus Immune Globulin (Human) — HyperTET® S/D treated with solvent/detergent is a colorless to pale yellow or pink sterile solution of tetanus hyperimmune immune globulin for intramuscular administration; it is preservative-free, in a latex-free delivery system. HyperTET S/D is prepared by cold ethanol fractionation fromthe plasma of donors immunized with tetanus toxoid. The immune globulin is isolated from solubilized Cohn Fraction II. The Fraction II solution is adjusted to a final concentration of 0.3% tri-n-butyl phosphate (TNBP) and 0.2% sodium cholate. After the addition of solvent (TNBP) and detergent (sodium cholate), the solution is heated to 30°C and maintained at that temperature for not less than 6 hours. After the viral inactivation step, the reactants are removed by precipitation, filtration and finally ultrafiltration and diafiltration. HyperTET S/D is formulated as a 15–18% protein solution at a pH of 6.4–7.2 in 0.21–0.32 M glycine. HyperTET S/D is then incubated in the final container for 21–28 days at 20–27°C. The product is standardized against the U.S. Standard Antitoxin and the U.S. Control Tetanus Toxin and contains not less than 250 tetanus antitoxin units per container. |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13407 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Immune Sera and Immunoglobulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | Hypertet S/d |
| Company | Grifols Therapeutics Llc |
| Brand Description | Grifols Therapeutics Llc |
| Prescribed For | Intramuscular |
| Chemical Name | 250 [iU] /mL |
| Formulation | None known. |
| Physical Appearance | Slight soreness at the site of injection and slight temperature elevation may be noted at times. Sensitization to repeated injections of human immunoglobulin is extremely rare. In the course of routine injections of large numbers of persons with immunoglobulin there have been a few isolated occurrences of angio neurotic edema, nephrotic syndrome, and anaphylactic shock after injection. |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13408 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Immunoglobulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | Hypertet S/d |
| Company | Grifols Therapeutics Llc |
| Brand Description | Grifols Therapeutics Llc |
| Prescribed For | Intramuscular |
| Chemical Name | 250 unit/1 |
| Formulation | None known. |
| Physical Appearance | Slight soreness at the site of injection and slight temperature elevation may be noted at times. Sensitization to repeated injections of human immunoglobulin is extremely rare. In the course of routine injections of large numbers of persons with immunoglobulin there have been a few isolated occurrences of angio neurotic edema, nephrotic syndrome, and anaphylactic shock after injection. |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13409 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13410 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Serum |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13411 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Serum Globulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 13412 |
| Therapeutic ID | Th1401 |
| Protein Name | Tetanus immune globulin, human |
| Sequence | >Th1401_Tetanus_immune_globulin,_human EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | Half life is about 23 days [FDA Label]. |
| Description | Tetanus Immune Globulin is manufactured from human plasma [FDA Label]. It contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus in wounded patients. |
| Indication/Disease | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
| Pharmacodynamics | Human clostridium tetani toxoid immune globulin prevents tetanus toxoid from damaging tissue and producing the symptoms associated with tetanus [FDA Label]. |
| Mechanism of Action | The immune globulin binds to tetanus toxiod, interfering with the normal interaction of the toxoid with human tissue. This prevents the toxoid from invading the nervous system and producing painful muscle spasms as well as autonomic dysfunction [A19535]. The Clostridium tetani bacterium is killed either via antibiotic treatment of the host's immune system and immune globulin-bound toxoid is likely broken down by phagocytic immune cells. |
| Toxicity | No toxicological testing has been performed. Isolated cases of angioneurotic edema, nephrotic syndrome, and anaphylactic shock after injection have been noted [FDA Label]. |
| Metabolism | NA |
| Absorption | Tmax for intramuscular administration is 2 days [FDA Label]. |
| NA | |
| Clearance | NA |
| Categories | Specific Immunoglobulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tetanus toxin |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |