Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1360 details |
| Primary information | |
|---|---|
| ID | 12848 |
| Therapeutic ID | Th1360 |
| Protein Name | Onercept |
| Sequence | >Th1360_Onercept DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFCCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders and crohn's disease. |
| Pharmacodynamics | NA |
| Mechanism of Action | Tumor necrosis factor (TNF) is a proinflammatory cytokine that plays a pivotal part in the pathogenesis of Crohn’s disease (CD).1 A number of anti-TNF therapies have been developed for the treatment of CD. Onercept is a recombinant form of the soluble human p55 TNF-greek small letter alpha receptor (also known as TNF-binding protein 1) produced by recombinant DNA technology. Its putative mechanism of action involves neutralizing the effects of TNF by the formation of high-affinity complexes. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 12849 |
| Therapeutic ID | Th1360 |
| Protein Name | Onercept |
| Sequence | >Th1360_Onercept DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFCCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders and crohn's disease. |
| Pharmacodynamics | NA |
| Mechanism of Action | Tumor necrosis factor (TNF) is a proinflammatory cytokine that plays a pivotal part in the pathogenesis of Crohn’s disease (CD).1 A number of anti-TNF therapies have been developed for the treatment of CD. Onercept is a recombinant form of the soluble human p55 TNF-greek small letter alpha receptor (also known as TNF-binding protein 1) produced by recombinant DNA technology. Its putative mechanism of action involves neutralizing the effects of TNF by the formation of high-affinity complexes. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Membrane Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 12850 |
| Therapeutic ID | Th1360 |
| Protein Name | Onercept |
| Sequence | >Th1360_Onercept DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFCCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders and crohn's disease. |
| Pharmacodynamics | NA |
| Mechanism of Action | Tumor necrosis factor (TNF) is a proinflammatory cytokine that plays a pivotal part in the pathogenesis of Crohn’s disease (CD).1 A number of anti-TNF therapies have been developed for the treatment of CD. Onercept is a recombinant form of the soluble human p55 TNF-greek small letter alpha receptor (also known as TNF-binding protein 1) produced by recombinant DNA technology. Its putative mechanism of action involves neutralizing the effects of TNF by the formation of high-affinity complexes. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Polyethylene Glycols |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 12851 |
| Therapeutic ID | Th1360 |
| Protein Name | Onercept |
| Sequence | >Th1360_Onercept DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFCCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders and crohn's disease. |
| Pharmacodynamics | NA |
| Mechanism of Action | Tumor necrosis factor (TNF) is a proinflammatory cytokine that plays a pivotal part in the pathogenesis of Crohn’s disease (CD).1 A number of anti-TNF therapies have been developed for the treatment of CD. Onercept is a recombinant form of the soluble human p55 TNF-greek small letter alpha receptor (also known as TNF-binding protein 1) produced by recombinant DNA technology. Its putative mechanism of action involves neutralizing the effects of TNF by the formation of high-affinity complexes. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 12852 |
| Therapeutic ID | Th1360 |
| Protein Name | Onercept |
| Sequence | >Th1360_Onercept DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFCCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders and crohn's disease. |
| Pharmacodynamics | NA |
| Mechanism of Action | Tumor necrosis factor (TNF) is a proinflammatory cytokine that plays a pivotal part in the pathogenesis of Crohn’s disease (CD).1 A number of anti-TNF therapies have been developed for the treatment of CD. Onercept is a recombinant form of the soluble human p55 TNF-greek small letter alpha receptor (also known as TNF-binding protein 1) produced by recombinant DNA technology. Its putative mechanism of action involves neutralizing the effects of TNF by the formation of high-affinity complexes. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Receptors, Death Domain |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 12853 |
| Therapeutic ID | Th1360 |
| Protein Name | Onercept |
| Sequence | >Th1360_Onercept DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFCCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in psoriasis and psoriatic disorders and crohn's disease. |
| Pharmacodynamics | NA |
| Mechanism of Action | Tumor necrosis factor (TNF) is a proinflammatory cytokine that plays a pivotal part in the pathogenesis of Crohn’s disease (CD).1 A number of anti-TNF therapies have been developed for the treatment of CD. Onercept is a recombinant form of the soluble human p55 TNF-greek small letter alpha receptor (also known as TNF-binding protein 1) produced by recombinant DNA technology. Its putative mechanism of action involves neutralizing the effects of TNF by the formation of high-affinity complexes. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Recombinant Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Tumor necrosis factor |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |