Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1250 details |
| Primary information | |
|---|---|
| ID | 11555 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Adjuvants, Immunologic |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Pentostatin,Peginterferon alfa-2a,Pegfilgrastim,Peginterferon alfa-2b,Pegaspargase,Pegvisomant,Propylene glycol,Heptaethylene glycol,Pegaptanib,Egaptivon pegol,PEG-uricase,Peginterferon alfacon-1,GlycoPEG-GCSF,Pegnivacogin,Pegpleranib,Pegsunercept,Polidocanol,Peginesatide,Certolizumab pegol,Methoxy polyethylene glycol-epoetin beta,Peginterferon beta-1a,Pegloticase,Polyethylene glycol,Antihemophilic factor (recombinant), PEGylated,Insulin peglispro,Eptacog alfa pegol (activated),Olaptesed Pegol,Abicipar Pegol,Lexaptepid pegol,Cepeginterferon alfa-2B,Pegvaliase,Pegamotecan,Lipegfilgrastim,Nonacog beta pegol,Damoctocog alfa pegol,Elapegademase |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | Adagen |
| Company | Leadiant Biosciences, Inc. |
| Brand Description | Leadiant Biosciences, Inc. |
| Prescribed For | Intramuscular |
| Chemical Name | 250 [iU]/1mL |
| Formulation | There is no evidence to support the safety and efficacy of ADAGEN® (pegademase bovine) Injection as preparatory or support therapy for bone marrow transplantation. Since ADAGEN®(pegademase bovine) Injection is administered by intramuscular injection, it should be used with caution in patients with thrombocytopenia and should not be used if thrombocytopenia is severe. |
| Physical Appearance | headache injection site reactions (swelling, redness, pain, or hives). |
| Route of Administration | ADAGEN® (pegademase bovine) Injection is indicated for enzyme replacement therapy for adenosine deaminase (ADA) deficiency in patients with severe combined immunodeficiency disease (SCID) who are not suitable candidates for – or who have failed – bone marrow transplantation. ADAGEN® (pegademase bovine) Injection is recommended for use in infants from birth or in children of any age at the time of diagnosis. ADAGEN® (pegademase bovine) Injection is not intended as a replacement for HLA identical bone marrow transplant therapy. ADAGEN® (pegademase bovine) Injection is also not intended to replace continued close medical supervision and the initiation of appropriate diagnostic tests and therapy (e.g., antibiotics, nutrition, oxygen, gammaglobulin) as indicated for intercurrent illnesses. |
| Recommended Dosage | It is used to treat adenosine deaminase deficiency in people who have a weak immune system. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11556 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Aminohydrolases |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11557 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Antineoplastic and Immunomodulating Agents |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11558 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Bovine Intestinal Adenosine Deaminase |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11559 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Drug Carriers |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11560 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Enzymes |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11561 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Enzymes and Coenzymes |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11562 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Hydrolases |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11563 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Nucleoside Deaminases |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11564 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Pegylated agents |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 11565 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL |
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA | |
| Clearance | NA |
| Categories | Severe Combined Immunodeficiency |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |