Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1245 details
Primary information
ID11372
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesAdjuvants, Immunologic
Patents Number2172664
Date of Issue03-10-2000
Date of Expiry26-03-2016
Drug InteractionDenosumab,Etanercept,Peginterferon alfa-2a,Interferon alfa-n1,Interferon alfa-n3,Peginterferon alfa-2b,Anakinra,Interferon gamma-1b,Adalimumab,Gemtuzumab ozogamicin,Pegaspargase,Infliximab,Interferon beta-1b,Interferon alfacon-1,Rituximab,Basiliximab,Muromonab,Ibritumomab tiuxetan,Tositumomab,Alemtuzumab,Alefacept,Efalizumab,Antithymocyte immunoglobulin (rabbit),Interferon alfa-2b,Daclizumab,Phenylalanine,Flunisolide,Bortezomib,Cladribine,Carmustine,Amsacrine,Bleomycin,Chlorambucil,Raltitrexed,Mitomycin,Bexarotene,Vindesine,Floxuridine,Indomethacin,Tioguanine,Vinorelbine,Dexrazoxane,Beclomethasone dipropionate,Sorafenib,Streptozocin,Trifluridine,Gemcitabine,Betamethasone,Teniposide,Epirubicin,Chloramphenicol,Lenalidomide,Altretamine,Zidovudine,Cisplatin,Oxaliplatin,Cyclophosphamide,Vincristine,Fluorouracil,Propylthiouracil,Pentostatin,Methotrexate,Carbamazepine,Vinblastine,Fluticasone propionate,Fluocinolone acetonide,Linezolid,Imatinib,Triamcinolone,Clofarabine,Prednisone,Pemetrexed,Fludrocortisone,Mycophenolate mofetil,Daunorubicin,Tretinoin,Irinotecan,Methimazole,Etoposide,Sulfasalazine,Dacarbazine,Temozolomide,Penicillamine,Prednisolone,Sirolimus,Mechlorethamine,Azacitidine,Carboplatin,Methylprednisolone,Dactinomycin,Cytarabine,Azathioprine,Doxorubicin,Hydroxyurea,Busulfan,Mycophenolic acid,Topotecan,Mercaptopurine,Thalidomide,Melphalan,Fludarabine,Flucytosine,Capecitabine,Trilostane,Procarbazine,Arsenic trioxide,Idarubicin,Ifosfamide,Estramustine,Mitoxantrone,Lomustine,Budesonide,Paclitaxel,Dexamethasone,Docetaxel,Dasatinib,Eculizumab,Decitabine,Sunitinib,Nelarabine,Abatacept,Corticotropin,Cortisone acetate,Paramethasone,Ciclesonide,Stepronin,Everolimus,Hydroxychloroquine,Castanospermine,Vorinostat,2-Methoxyethanol,Brequinar,Thiotepa,Aldosterone,Ixabepilone,Nilotinib,Pirfenidone,Afelimomab,Belinostat,Trabectedin,Interferon alfa,Glatiramer,Gallium nitrate,Briakinumab,Human interferon omega-1,Apremilast,Trastuzumab emtansine,Canakinumab,Tocilizumab,Temsirolimus,Rilonacept,Pazopanib,Panobinostat,Mepolizumab,Bosutinib,Abetimus,Golimumab,Belatacept,Bendamustine,Cabazitaxel,Pralatrexate,Wortmannin,Brentuximab vedotin,Eribulin,Ruxolitinib,Belimumab,Teriflunomide,Carfilzomib,Ponatinib,Certolizumab pegol,Fluticasone furoate,Dimethyl fumarate,Pomalidomide,Obinutuzumab,Fluprednidene,Secukinumab,Vedolizumab,Siltuximab,Blinatumomab,Ibrutinib,Idelalisib,Palbociclib,Olaparib,Dinutuximab,Vilanterol,Tixocortol,Peginterferon beta-1a,Antilymphocyte immunoglobulin (horse),Fluprednisolone,Meprednisone,Tepoxalin,Dexamethasone isonicotinate,Melengestrol,Ixekizumab,Ravulizumab,Pirarubicin,Voclosporin,Peficitinib,Sarilumab,Brodalumab,Sirukumab,Baricitinib,Guselkumab,Deflazacort,Ocrelizumab,Triptolide,Siponimod,Ozanimod,Mizoribine,Gusperimus,Cepeginterferon alfa-2B,Trofosfamide,Doxifluridine,Deoxyspergualin,Acteoside,Cortivazol,Hypericin,9-(N-methyl-L-isoleucine)-cyclosporin A,Prednylidene,Fluocortin,Begelomab,Fluperolone,Cloprednol,Fluclorolone,Fluticasone,Tetrandrine,Monomethyl fumarate,Mometasone furoate,Hydrocortisone acetate,Hydrocortisone succinate,Emapalumab,Risankizumab,Rozanolixizumab,Bleselumab,Clobetasol propionate,Fluocinonide,Hydrocortisone butyrate,Desoximetasone,Mometasone,Fluocortolone,Fluorometholone,Difluocortolone,Upadacitinib,Ponesimod,Lexacalcitol,Inolimomab,Fasitibant,Natalizumab,Pimecrolimus,Roflumilast,Sipuleucel-T,Aldesleukin,Clozapine,Methadone,Ribavirin,Zolmitriptan,Sulfamethoxazole,Telbivudine,Leflunomide,Tofacitinib,Trastuzumab,Fingolimod,Tacrolimus,Caffeine,Dyphylline,Pentoxifylline,Oxtriphylline,Theobromine,Fenethylline,8-azaguanine,7,9-Dimethylguanine,Xanthine,7-Deazaguanine,Guanine,9-Methylguanine,Peldesine,Hypoxanthine,9-Deazaguanine,Propentofylline,Valomaciclovir,3-isobutyl-1-methyl-7H-xanthine,Uric acid,Doxofylline,6-O-benzylguanine,Lisofylline,Lobucavir,Cafedrine,Theodrenaline,Bamifylline,Proxyphylline,Acefylline,Etamiphylline,Pentifylline,Bufylline,Bromotheophylline,Furafylline,8-chlorotheophylline,PCS-499,G17DT,PEV3A,INGN 225,Rindopepimut,SRP 299,GI-5005,Vitespen,TG4010,Anthrax immune globulin human,Rabies virus inactivated antigen, B,Haemophilus influenzae type B strain 1482 capsular polysaccharide tetanus toxoid conjugate antigen,Rotavirus vaccine,Rabies virus inactivated antigen, A,Haemophilus influenzae type B capsular polysaccharide meningococcal outer membrane protein conjugate antigen,Clostridium tetani toxoid antigen (formaldehyde inactivated),Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated),Influenza A virus A/California/7/2009 X-181 (H1N1) antigen (propiolactone inactivated),Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated),Influenza B virus B/Brisbane/60/2008 antigen (formaldehyde inactivated),Typhoid Vi polysaccharide vaccine,Hepatitis A Vaccine,Haemophilus influenzae type B strain 20752 capsular polysaccharide tetanus toxoid conjugate antigen,Influenza A virus A/Brisbane/59/2007(H1N1) hemagglutinin antigen (propiolactone inactivated),Influenza B virus B/Brisbane/60/2008 hemagglutinin antigen (propiolactone inactivated),Influenza A virus A/California/7/2009 X-181 (H1N1) hemagglutinin antigen (propiolactone inactivated),Influenza B virus B/Brisbane/60/2008 antigen (propiolactone inactivated),Rabies immune globulin, human,Hepatitis B Vaccine (Recombinant),Tecemotide,Typhoid vaccine,Influenza A virus A/Victoria/210/2009 X-187 (H3N2) hemagglutinin antigen (formaldehyde inactivated),Influenza B virus B/Brisbane/60/2008 hemagglutinin antigen (formaldehyde inactivated),Influenza A virus A/California/7/2009 (H1N1) live (attenuated) antigen,Influenza A virus A/Victoria/210/2009 X-187 (H3N2) antigen (formaldehyde inactivated),Influenza A virus A/Perth/16/2009 (H3N2) live (attenuated) antigen,Influenza A virus A/Uruguay/716/2007(H3N2) antigen (propiolactone inactivated),Influenza A virus A/Brisbane/59/2007(H1N1) antigen (propiolactone inactivated),Smallpox (Vaccinia) Vaccine, Live,Pertussis vaccine,Yersinia pestis 195/p antigen (formaldehyde inactivated),Varicella zoster vaccine (recombinant),Modified vaccinia ankara,Ebola Zaire vaccine (live, attenuated),Moderna COVID-19 Vaccine,Measles virus vaccine live attenuated,Abciximab,Eptifibatide,Ticlopidine,Tirofiban,Acetylsalicylic acid,Dipyridamole,Iloprost,Sulfinpyrazone,Ridogrel,Sevoflurane,Epoprostenol,Nimesulide,Tesmilifene,Defibrotide,Beraprost,Ibudilast,Andrographolide,Caplacizumab,Prasugrel,Cangrelor,Tranilast,Triflusal,Ticagrelor,Icosapent ethyl,Vorapaxar,Trapidil,Naftopidil,Sarpogrelate,Ifetroban,Nitroaspirin,Ketanserin,Indobufen,Butylphthalide,Hydroxytyrosol,Ramatroban,Picotamide,Cloricromen,Linsidomine,Buflomedil,Relcovaptan,Maritime pine extract,Resveratrol,Lipegfilgrastim,Rubella virus vaccine,Varicella zoster vaccine (live/attenuated),Bacillus calmette-guerin substrain tice live antigen,Bacillus calmette-guerin substrain connaught live antigen,Yellow fever vaccine,Anthrax vaccine,Typhoid Vaccine Live,Bacillus calmette-guerin substrain danish 1331 live antigen,BCG vaccine,Human adenovirus e serotype 4 strain cl-68578 antigen,Vibrio cholerae CVD 103-HgR strain live antigen,Adenovirus type 7 vaccine live,Palifermin,Fluvoxamine,Betaxolol,Disopyramide,Lidocaine,Conjugated estrogens,Ropivacaine,Acetaminophen,Olanzapine,Chlorzoxazone,Grepafloxacin,Mirtazapine,Mexiletine,Tacrine,Triamterene,Promazine,Zolpidem,Entecavir,Nabumetone,Quinine,Fluoxetine,Chlorpromazine,Flutamide,Haloperidol,Albendazole,Rofecoxib,Cinnarizine,Propranolol,Diclofenac,Guanabenz,Verapamil,Paroxetine,Thiabendazole,Riluzole,Zileuton,Clopidogrel,Estradiol,Acyclovir,Naproxen,Trifluoperazine,Perphenazine,Terbinafine,Ranitidine,Ethanol,Maprotiline,Alosetron,Lomefloxacin,Ramelteon,Frovatriptan,Levobupivacaine,Cinacalcet,Selegiline,Tocainide,Praziquantel,Melatonin,Primaquine,Hesperetin,Nifedipine,Carvedilol,Cilostazol,Propafenone,Domperidone,Dexfenfluramine,Rasagiline,Temafloxacin,Aminophenazone,Antipyrine,Bromazepam,Thiothixene,Etoricoxib,Genistein,Phenacetin,Estrone sulfate,Flunarizine,Lorcaserin,Lofexidine,Mianserin,Eltrombopag,Asenapine,Vadimezan,Dapagliflozin,Agomelatine,Benzyl alcohol,Capsaicin,(R)-warfarin,Perampanel,Tasimelteon,Stiripentol,Zotepine,Propacetamol,Ramosetron,Binimetinib,Voxilaprevir,Triclabendazole,Rucaparib,Dihydralazine,Estradiol acetate,Estradiol benzoate,Estradiol cypionate,Estradiol dienanthate,Estradiol valerate,Istradefylline,Azelastine,Efavirenz,Metoclopramide,Bicifadine,GTS-21,Flecainide,Ethinylestradiol,Amitriptyline,Doxepin,Mephenytoin,Cyclobenzaprine,Selumetinib,Penciclovir,Fenfluramine,Mefenamic acid,Ondansetron,Methylene blue,Benzocaine,Theophylline,Warfarin,Tizanidine,Pimozide,Aminophylline,Acenocoumarol,Anagrelide,Erlotinib,Axitinib,Tegafur,Enasidenib,Tamoxifen,Imipramine,Clonidine,Clomipramine,Lepirudin,Bivalirudin,Alteplase,Urokinase,Reteplase,Anistreplase,Tenecteplase,Drotrecogin alfa,Streptokinase,Dicoumarol,Argatroban,Ardeparin,Phenindione,Fondaparinux,Pentosan polysulfate,Phenprocoumon,Heparin,Enoxaparin,4-hydroxycoumarin,Coumarin,Ximelagatran,Desmoteplase,Ancrod,Fibrinolysin,Rivaroxaban,Sulodexide,Semuloparin,Idraparinux,Astaxanthin,Apixaban,Otamixaban,Amediplase,Dabigatran etexilate,Danaparoid,Dalteparin,Tinzaparin,Ferulic acid,Ethyl biscoumacetate,Nadroparin,Ditazole,Edoxaban,Potassium citrate,Sodium citrate,Dextran,Bemiparin,Parnaparin,Desirudin,Zinc citrate,Antithrombin Alfa,Protein C,Antithrombin III human,Letaxaban,Darexaban,Betrixaban,Nafamostat,Monteplase,Gabexate,Fluindione,Protein S human,Brinase,Clorindione,Diphenadione,Tioclomarol,Melagatran,Saruplase,(S)-Warfarin,Tocopherylquinone,Edetate calcium disodium anhydrous,Dabigatran,Troxerutin,Edetic acid,Reviparin,Dermatan sulfate,SR-123781A,Dociparstat sodium,Methyclothiazide,Bendroflumethiazide,Benzthiazide,Cyclothiazide,Hydroflumethiazide,Chlorothiazide,Hydrochlorothiazide,Trichlormethiazide,Polythiazide,Mebutizide,Cyclopenthiazide,Buthiazide,Tedizolid phosphate,Cyclosporine,Ropinirole,Cyanocobalamin,Allopurinol,Magnesium,Lopinavir,Inebilizumab,Flupentixol,Bacillus calmette-guerin substrain russian BCG-I live antigen,Fexinidazole,Allogeneic processed thymus tissue,Tick-borne encephalitis vaccine (whole virus, inactivated),Ropeginterferon alfa-2b,Nuvaxovid
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon A Soln Inj 6 Million
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name6000000 unit / mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11373
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesAlfa Interferons
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon A Sterile Pws 18m Unit/vial
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name18000000 unit / vial
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11374
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesAntineoplastic and Immunomodulating Agents
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon A Sterile Pws 3m Unit/vial
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name3000000 unit / vial
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11375
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesCancer immunotherapy
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon A Sterile Pws 9m Unit/vial
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name9000000 unit / vial
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11376
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesCytochrome P-450 CYP1A2 Inhibitors
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A
CompanyGenentech, Inc.
Brand DescriptionGenentech, Inc.
Prescribed ForSubcutaneous
Chemical Name11.1 ug/0.5mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationAlpheon is a solution for injection that contains the active substance interferon alfa-2a.
Recommended DosageRoferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis).
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11377
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesCytochrome P-450 CYP1A2 Inhibitors (strength unknown)
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A
CompanyGenentech, Inc.
Brand DescriptionGenentech, Inc.
Prescribed ForSubcutaneous
Chemical Name22.2 ug/0.5mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationAlpheon is a solution for injection that contains the active substance interferon alfa-2a.
Recommended DosageRoferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis).
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11378
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesCytochrome P-450 Enzyme Inhibitors
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A
CompanyGenentech, Inc.
Brand DescriptionGenentech, Inc.
Prescribed ForSubcutaneous
Chemical Name33.3 ug/0.5mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationAlpheon is a solution for injection that contains the active substance interferon alfa-2a.
Recommended DosageRoferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis).
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11379
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesImmunosuppressive Agents
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Sol Inj 3million Iu/vial
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name3000000 unit / mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11380
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesImmunotherapy
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Soln-liq Im Sc 4.5million I.u/ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name4500000 IU/mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11381
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesInterferon alpha
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Soln-liq Im Sc 9million I.U./ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name9000000 IU/ml
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11382
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesInterferons
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Solution 18 Million I.U./3ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name18000000 IU/3mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11383
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesMyelosuppressive Agents
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Solution 3 Million I.U./ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name3 m / mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11384
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesNA
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Solution 6 Million I.U./ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name6000000 IU/mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11385
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesNA
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Solution Inj 36000000unit/ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name36000000 unit / mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA


Primary information
ID11386
Therapeutic IDTh1245
Protein NameInterferon alfa-2a
Sequence>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight19241.1
Chemical FormulaC860H1353N227O255S9
Isoelectric Point5.99
Hydrophobicity-0.336
Melting pointNA
Half-lifeThe IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
DescriptionInterferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/DiseaseFor the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityInterferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
MetabolismNA
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
* 0.223 to 0.748 L/kg [healthy people]
Clearance* 2.14 - 3.62 mL/min/kg [healthy]
CategoriesNA
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetInterferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand NameRoferon-A Solution Inj. 9million I.U./0.9ml
CompanyHoffmann La Roche
Brand DescriptionHoffmann La Roche
Prescribed ForIntramuscular; Subcutaneous
Chemical Name9000000 unit / .9 mL
FormulationRoferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA