Detailed description page of ThPDB2
This page displays user query in tabular form. |
Th1245 details |
Primary information | |
---|---|
ID | 11372 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Adjuvants, Immunologic |
Patents Number | 2172664 |
Date of Issue | 03-10-2000 |
Date of Expiry | 26-03-2016 |
Drug Interaction | Denosumab,Etanercept,Peginterferon alfa-2a,Interferon alfa-n1,Interferon alfa-n3,Peginterferon alfa-2b,Anakinra,Interferon gamma-1b,Adalimumab,Gemtuzumab ozogamicin,Pegaspargase,Infliximab,Interferon beta-1b,Interferon alfacon-1,Rituximab,Basiliximab,Muromonab,Ibritumomab tiuxetan,Tositumomab,Alemtuzumab,Alefacept,Efalizumab,Antithymocyte immunoglobulin (rabbit),Interferon alfa-2b,Daclizumab,Phenylalanine,Flunisolide,Bortezomib,Cladribine,Carmustine,Amsacrine,Bleomycin,Chlorambucil,Raltitrexed,Mitomycin,Bexarotene,Vindesine,Floxuridine,Indomethacin,Tioguanine,Vinorelbine,Dexrazoxane,Beclomethasone dipropionate,Sorafenib,Streptozocin,Trifluridine,Gemcitabine,Betamethasone,Teniposide,Epirubicin,Chloramphenicol,Lenalidomide,Altretamine,Zidovudine,Cisplatin,Oxaliplatin,Cyclophosphamide,Vincristine,Fluorouracil,Propylthiouracil,Pentostatin,Methotrexate,Carbamazepine,Vinblastine,Fluticasone propionate,Fluocinolone acetonide,Linezolid,Imatinib,Triamcinolone,Clofarabine,Prednisone,Pemetrexed,Fludrocortisone,Mycophenolate mofetil,Daunorubicin,Tretinoin,Irinotecan,Methimazole,Etoposide,Sulfasalazine,Dacarbazine,Temozolomide,Penicillamine,Prednisolone,Sirolimus,Mechlorethamine,Azacitidine,Carboplatin,Methylprednisolone,Dactinomycin,Cytarabine,Azathioprine,Doxorubicin,Hydroxyurea,Busulfan,Mycophenolic acid,Topotecan,Mercaptopurine,Thalidomide,Melphalan,Fludarabine,Flucytosine,Capecitabine,Trilostane,Procarbazine,Arsenic trioxide,Idarubicin,Ifosfamide,Estramustine,Mitoxantrone,Lomustine,Budesonide,Paclitaxel,Dexamethasone,Docetaxel,Dasatinib,Eculizumab,Decitabine,Sunitinib,Nelarabine,Abatacept,Corticotropin,Cortisone acetate,Paramethasone,Ciclesonide,Stepronin,Everolimus,Hydroxychloroquine,Castanospermine,Vorinostat,2-Methoxyethanol,Brequinar,Thiotepa,Aldosterone,Ixabepilone,Nilotinib,Pirfenidone,Afelimomab,Belinostat,Trabectedin,Interferon alfa,Glatiramer,Gallium nitrate,Briakinumab,Human interferon omega-1,Apremilast,Trastuzumab emtansine,Canakinumab,Tocilizumab,Temsirolimus,Rilonacept,Pazopanib,Panobinostat,Mepolizumab,Bosutinib,Abetimus,Golimumab,Belatacept,Bendamustine,Cabazitaxel,Pralatrexate,Wortmannin,Brentuximab vedotin,Eribulin,Ruxolitinib,Belimumab,Teriflunomide,Carfilzomib,Ponatinib,Certolizumab pegol,Fluticasone furoate,Dimethyl fumarate,Pomalidomide,Obinutuzumab,Fluprednidene,Secukinumab,Vedolizumab,Siltuximab,Blinatumomab,Ibrutinib,Idelalisib,Palbociclib,Olaparib,Dinutuximab,Vilanterol,Tixocortol,Peginterferon beta-1a,Antilymphocyte immunoglobulin (horse),Fluprednisolone,Meprednisone,Tepoxalin,Dexamethasone isonicotinate,Melengestrol,Ixekizumab,Ravulizumab,Pirarubicin,Voclosporin,Peficitinib,Sarilumab,Brodalumab,Sirukumab,Baricitinib,Guselkumab,Deflazacort,Ocrelizumab,Triptolide,Siponimod,Ozanimod,Mizoribine,Gusperimus,Cepeginterferon alfa-2B,Trofosfamide,Doxifluridine,Deoxyspergualin,Acteoside,Cortivazol,Hypericin,9-(N-methyl-L-isoleucine)-cyclosporin A,Prednylidene,Fluocortin,Begelomab,Fluperolone,Cloprednol,Fluclorolone,Fluticasone,Tetrandrine,Monomethyl fumarate,Mometasone furoate,Hydrocortisone acetate,Hydrocortisone succinate,Emapalumab,Risankizumab,Rozanolixizumab,Bleselumab,Clobetasol propionate,Fluocinonide,Hydrocortisone butyrate,Desoximetasone,Mometasone,Fluocortolone,Fluorometholone,Difluocortolone,Upadacitinib,Ponesimod,Lexacalcitol,Inolimomab,Fasitibant,Natalizumab,Pimecrolimus,Roflumilast,Sipuleucel-T,Aldesleukin,Clozapine,Methadone,Ribavirin,Zolmitriptan,Sulfamethoxazole,Telbivudine,Leflunomide,Tofacitinib,Trastuzumab,Fingolimod,Tacrolimus,Caffeine,Dyphylline,Pentoxifylline,Oxtriphylline,Theobromine,Fenethylline,8-azaguanine,7,9-Dimethylguanine,Xanthine,7-Deazaguanine,Guanine,9-Methylguanine,Peldesine,Hypoxanthine,9-Deazaguanine,Propentofylline,Valomaciclovir,3-isobutyl-1-methyl-7H-xanthine,Uric acid,Doxofylline,6-O-benzylguanine,Lisofylline,Lobucavir,Cafedrine,Theodrenaline,Bamifylline,Proxyphylline,Acefylline,Etamiphylline,Pentifylline,Bufylline,Bromotheophylline,Furafylline,8-chlorotheophylline,PCS-499,G17DT,PEV3A,INGN 225,Rindopepimut,SRP 299,GI-5005,Vitespen,TG4010,Anthrax immune globulin human,Rabies virus inactivated antigen, B,Haemophilus influenzae type B strain 1482 capsular polysaccharide tetanus toxoid conjugate antigen,Rotavirus vaccine,Rabies virus inactivated antigen, A,Haemophilus influenzae type B capsular polysaccharide meningococcal outer membrane protein conjugate antigen,Clostridium tetani toxoid antigen (formaldehyde inactivated),Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated),Influenza A virus A/California/7/2009 X-181 (H1N1) antigen (propiolactone inactivated),Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated),Influenza B virus B/Brisbane/60/2008 antigen (formaldehyde inactivated),Typhoid Vi polysaccharide vaccine,Hepatitis A Vaccine,Haemophilus influenzae type B strain 20752 capsular polysaccharide tetanus toxoid conjugate antigen,Influenza A virus A/Brisbane/59/2007(H1N1) hemagglutinin antigen (propiolactone inactivated),Influenza B virus B/Brisbane/60/2008 hemagglutinin antigen (propiolactone inactivated),Influenza A virus A/California/7/2009 X-181 (H1N1) hemagglutinin antigen (propiolactone inactivated),Influenza B virus B/Brisbane/60/2008 antigen (propiolactone inactivated),Rabies immune globulin, human,Hepatitis B Vaccine (Recombinant),Tecemotide,Typhoid vaccine,Influenza A virus A/Victoria/210/2009 X-187 (H3N2) hemagglutinin antigen (formaldehyde inactivated),Influenza B virus B/Brisbane/60/2008 hemagglutinin antigen (formaldehyde inactivated),Influenza A virus A/California/7/2009 (H1N1) live (attenuated) antigen,Influenza A virus A/Victoria/210/2009 X-187 (H3N2) antigen (formaldehyde inactivated),Influenza A virus A/Perth/16/2009 (H3N2) live (attenuated) antigen,Influenza A virus A/Uruguay/716/2007(H3N2) antigen (propiolactone inactivated),Influenza A virus A/Brisbane/59/2007(H1N1) antigen (propiolactone inactivated),Smallpox (Vaccinia) Vaccine, Live,Pertussis vaccine,Yersinia pestis 195/p antigen (formaldehyde inactivated),Varicella zoster vaccine (recombinant),Modified vaccinia ankara,Ebola Zaire vaccine (live, attenuated),Moderna COVID-19 Vaccine,Measles virus vaccine live attenuated,Abciximab,Eptifibatide,Ticlopidine,Tirofiban,Acetylsalicylic acid,Dipyridamole,Iloprost,Sulfinpyrazone,Ridogrel,Sevoflurane,Epoprostenol,Nimesulide,Tesmilifene,Defibrotide,Beraprost,Ibudilast,Andrographolide,Caplacizumab,Prasugrel,Cangrelor,Tranilast,Triflusal,Ticagrelor,Icosapent ethyl,Vorapaxar,Trapidil,Naftopidil,Sarpogrelate,Ifetroban,Nitroaspirin,Ketanserin,Indobufen,Butylphthalide,Hydroxytyrosol,Ramatroban,Picotamide,Cloricromen,Linsidomine,Buflomedil,Relcovaptan,Maritime pine extract,Resveratrol,Lipegfilgrastim,Rubella virus vaccine,Varicella zoster vaccine (live/attenuated),Bacillus calmette-guerin substrain tice live antigen,Bacillus calmette-guerin substrain connaught live antigen,Yellow fever vaccine,Anthrax vaccine,Typhoid Vaccine Live,Bacillus calmette-guerin substrain danish 1331 live antigen,BCG vaccine,Human adenovirus e serotype 4 strain cl-68578 antigen,Vibrio cholerae CVD 103-HgR strain live antigen,Adenovirus type 7 vaccine live,Palifermin,Fluvoxamine,Betaxolol,Disopyramide,Lidocaine,Conjugated estrogens,Ropivacaine,Acetaminophen,Olanzapine,Chlorzoxazone,Grepafloxacin,Mirtazapine,Mexiletine,Tacrine,Triamterene,Promazine,Zolpidem,Entecavir,Nabumetone,Quinine,Fluoxetine,Chlorpromazine,Flutamide,Haloperidol,Albendazole,Rofecoxib,Cinnarizine,Propranolol,Diclofenac,Guanabenz,Verapamil,Paroxetine,Thiabendazole,Riluzole,Zileuton,Clopidogrel,Estradiol,Acyclovir,Naproxen,Trifluoperazine,Perphenazine,Terbinafine,Ranitidine,Ethanol,Maprotiline,Alosetron,Lomefloxacin,Ramelteon,Frovatriptan,Levobupivacaine,Cinacalcet,Selegiline,Tocainide,Praziquantel,Melatonin,Primaquine,Hesperetin,Nifedipine,Carvedilol,Cilostazol,Propafenone,Domperidone,Dexfenfluramine,Rasagiline,Temafloxacin,Aminophenazone,Antipyrine,Bromazepam,Thiothixene,Etoricoxib,Genistein,Phenacetin,Estrone sulfate,Flunarizine,Lorcaserin,Lofexidine,Mianserin,Eltrombopag,Asenapine,Vadimezan,Dapagliflozin,Agomelatine,Benzyl alcohol,Capsaicin,(R)-warfarin,Perampanel,Tasimelteon,Stiripentol,Zotepine,Propacetamol,Ramosetron,Binimetinib,Voxilaprevir,Triclabendazole,Rucaparib,Dihydralazine,Estradiol acetate,Estradiol benzoate,Estradiol cypionate,Estradiol dienanthate,Estradiol valerate,Istradefylline,Azelastine,Efavirenz,Metoclopramide,Bicifadine,GTS-21,Flecainide,Ethinylestradiol,Amitriptyline,Doxepin,Mephenytoin,Cyclobenzaprine,Selumetinib,Penciclovir,Fenfluramine,Mefenamic acid,Ondansetron,Methylene blue,Benzocaine,Theophylline,Warfarin,Tizanidine,Pimozide,Aminophylline,Acenocoumarol,Anagrelide,Erlotinib,Axitinib,Tegafur,Enasidenib,Tamoxifen,Imipramine,Clonidine,Clomipramine,Lepirudin,Bivalirudin,Alteplase,Urokinase,Reteplase,Anistreplase,Tenecteplase,Drotrecogin alfa,Streptokinase,Dicoumarol,Argatroban,Ardeparin,Phenindione,Fondaparinux,Pentosan polysulfate,Phenprocoumon,Heparin,Enoxaparin,4-hydroxycoumarin,Coumarin,Ximelagatran,Desmoteplase,Ancrod,Fibrinolysin,Rivaroxaban,Sulodexide,Semuloparin,Idraparinux,Astaxanthin,Apixaban,Otamixaban,Amediplase,Dabigatran etexilate,Danaparoid,Dalteparin,Tinzaparin,Ferulic acid,Ethyl biscoumacetate,Nadroparin,Ditazole,Edoxaban,Potassium citrate,Sodium citrate,Dextran,Bemiparin,Parnaparin,Desirudin,Zinc citrate,Antithrombin Alfa,Protein C,Antithrombin III human,Letaxaban,Darexaban,Betrixaban,Nafamostat,Monteplase,Gabexate,Fluindione,Protein S human,Brinase,Clorindione,Diphenadione,Tioclomarol,Melagatran,Saruplase,(S)-Warfarin,Tocopherylquinone,Edetate calcium disodium anhydrous,Dabigatran,Troxerutin,Edetic acid,Reviparin,Dermatan sulfate,SR-123781A,Dociparstat sodium,Methyclothiazide,Bendroflumethiazide,Benzthiazide,Cyclothiazide,Hydroflumethiazide,Chlorothiazide,Hydrochlorothiazide,Trichlormethiazide,Polythiazide,Mebutizide,Cyclopenthiazide,Buthiazide,Tedizolid phosphate,Cyclosporine,Ropinirole,Cyanocobalamin,Allopurinol,Magnesium,Lopinavir,Inebilizumab,Flupentixol,Bacillus calmette-guerin substrain russian BCG-I live antigen,Fexinidazole,Allogeneic processed thymus tissue,Tick-borne encephalitis vaccine (whole virus, inactivated),Ropeginterferon alfa-2b,Nuvaxovid |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon A Soln Inj 6 Million |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 6000000 unit / mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11373 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Alfa Interferons |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon A Sterile Pws 18m Unit/vial |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 18000000 unit / vial |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11374 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Antineoplastic and Immunomodulating Agents |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon A Sterile Pws 3m Unit/vial |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 3000000 unit / vial |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11375 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Cancer immunotherapy |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon A Sterile Pws 9m Unit/vial |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 9000000 unit / vial |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11376 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Cytochrome P-450 CYP1A2 Inhibitors |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A |
Company | Genentech, Inc. |
Brand Description | Genentech, Inc. |
Prescribed For | Subcutaneous |
Chemical Name | 11.1 ug/0.5mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | Alpheon is a solution for injection that contains the active substance interferon alfa-2a. |
Recommended Dosage | Roferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis). |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11377 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Cytochrome P-450 CYP1A2 Inhibitors (strength unknown) |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A |
Company | Genentech, Inc. |
Brand Description | Genentech, Inc. |
Prescribed For | Subcutaneous |
Chemical Name | 22.2 ug/0.5mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | Alpheon is a solution for injection that contains the active substance interferon alfa-2a. |
Recommended Dosage | Roferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis). |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11378 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Cytochrome P-450 Enzyme Inhibitors |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A |
Company | Genentech, Inc. |
Brand Description | Genentech, Inc. |
Prescribed For | Subcutaneous |
Chemical Name | 33.3 ug/0.5mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | Alpheon is a solution for injection that contains the active substance interferon alfa-2a. |
Recommended Dosage | Roferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis). |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11379 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Immunosuppressive Agents |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Sol Inj 3million Iu/vial |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 3000000 unit / mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11380 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Immunotherapy |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Soln-liq Im Sc 4.5million I.u/ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 4500000 IU/mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11381 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Interferon alpha |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Soln-liq Im Sc 9million I.U./ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 9000000 IU/ml |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11382 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Interferons |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Solution 18 Million I.U./3ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 18000000 IU/3mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11383 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | Myelosuppressive Agents |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Solution 3 Million I.U./ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 3 m / mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11384 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | NA |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Solution 6 Million I.U./ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 6000000 IU/mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11385 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | NA |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Solution Inj 36000000unit/ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 36000000 unit / mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |
Primary information | |
---|---|
ID | 11386 |
Therapeutic ID | Th1245 |
Protein Name | Interferon alfa-2a |
Sequence | >Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Molecular Weight | 19241.1 |
Chemical Formula | C860H1353N227O255S9 |
Isoelectric Point | 5.99 |
Hydrophobicity | -0.336 |
Melting point | NA |
Half-life | The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours). |
Description | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences. |
Indication/Disease | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
Pharmacodynamics | Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R. |
Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
Toxicity | Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair. |
Metabolism | NA |
Absorption | Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously. |
* 0.223 to 0.748 L/kg [healthy people] | |
Clearance | * 2.14 - 3.62 mL/min/kg [healthy] |
Categories | NA |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2 |
Brand Name | Roferon-A Solution Inj. 9million I.U./0.9ml |
Company | Hoffmann La Roche |
Brand Description | Hoffmann La Roche |
Prescribed For | Intramuscular; Subcutaneous |
Chemical Name | 9000000 unit / .9 mL |
Formulation | Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal. |
Physical Appearance | lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |