Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1245 details

Primary information
ID	11372
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Adjuvants, Immunologic
Patents Number	2172664
Date of Issue	03-10-2000
Date of Expiry	26-03-2016
Drug Interaction	Denosumab,Etanercept,Peginterferon alfa-2a,Interferon alfa-n1,Interferon alfa-n3,Peginterferon alfa-2b,Anakinra,Interferon gamma-1b,Adalimumab,Gemtuzumab ozogamicin,Pegaspargase,Infliximab,Interferon beta-1b,Interferon alfacon-1,Rituximab,Basiliximab,Muromonab,Ibritumomab tiuxetan,Tositumomab,Alemtuzumab,Alefacept,Efalizumab,Antithymocyte immunoglobulin (rabbit),Interferon alfa-2b,Daclizumab,Phenylalanine,Flunisolide,Bortezomib,Cladribine,Carmustine,Amsacrine,Bleomycin,Chlorambucil,Raltitrexed,Mitomycin,Bexarotene,Vindesine,Floxuridine,Indomethacin,Tioguanine,Vinorelbine,Dexrazoxane,Beclomethasone dipropionate,Sorafenib,Streptozocin,Trifluridine,Gemcitabine,Betamethasone,Teniposide,Epirubicin,Chloramphenicol,Lenalidomide,Altretamine,Zidovudine,Cisplatin,Oxaliplatin,Cyclophosphamide,Vincristine,Fluorouracil,Propylthiouracil,Pentostatin,Methotrexate,Carbamazepine,Vinblastine,Fluticasone propionate,Fluocinolone acetonide,Linezolid,Imatinib,Triamcinolone,Clofarabine,Prednisone,Pemetrexed,Fludrocortisone,Mycophenolate mofetil,Daunorubicin,Tretinoin,Irinotecan,Methimazole,Etoposide,Sulfasalazine,Dacarbazine,Temozolomide,Penicillamine,Prednisolone,Sirolimus,Mechlorethamine,Azacitidine,Carboplatin,Methylprednisolone,Dactinomycin,Cytarabine,Azathioprine,Doxorubicin,Hydroxyurea,Busulfan,Mycophenolic acid,Topotecan,Mercaptopurine,Thalidomide,Melphalan,Fludarabine,Flucytosine,Capecitabine,Trilostane,Procarbazine,Arsenic trioxide,Idarubicin,Ifosfamide,Estramustine,Mitoxantrone,Lomustine,Budesonide,Paclitaxel,Dexamethasone,Docetaxel,Dasatinib,Eculizumab,Decitabine,Sunitinib,Nelarabine,Abatacept,Corticotropin,Cortisone acetate,Paramethasone,Ciclesonide,Stepronin,Everolimus,Hydroxychloroquine,Castanospermine,Vorinostat,2-Methoxyethanol,Brequinar,Thiotepa,Aldosterone,Ixabepilone,Nilotinib,Pirfenidone,Afelimomab,Belinostat,Trabectedin,Interferon alfa,Glatiramer,Gallium nitrate,Briakinumab,Human interferon omega-1,Apremilast,Trastuzumab emtansine,Canakinumab,Tocilizumab,Temsirolimus,Rilonacept,Pazopanib,Panobinostat,Mepolizumab,Bosutinib,Abetimus,Golimumab,Belatacept,Bendamustine,Cabazitaxel,Pralatrexate,Wortmannin,Brentuximab vedotin,Eribulin,Ruxolitinib,Belimumab,Teriflunomide,Carfilzomib,Ponatinib,Certolizumab pegol,Fluticasone furoate,Dimethyl fumarate,Pomalidomide,Obinutuzumab,Fluprednidene,Secukinumab,Vedolizumab,Siltuximab,Blinatumomab,Ibrutinib,Idelalisib,Palbociclib,Olaparib,Dinutuximab,Vilanterol,Tixocortol,Peginterferon beta-1a,Antilymphocyte immunoglobulin (horse),Fluprednisolone,Meprednisone,Tepoxalin,Dexamethasone isonicotinate,Melengestrol,Ixekizumab,Ravulizumab,Pirarubicin,Voclosporin,Peficitinib,Sarilumab,Brodalumab,Sirukumab,Baricitinib,Guselkumab,Deflazacort,Ocrelizumab,Triptolide,Siponimod,Ozanimod,Mizoribine,Gusperimus,Cepeginterferon alfa-2B,Trofosfamide,Doxifluridine,Deoxyspergualin,Acteoside,Cortivazol,Hypericin,9-(N-methyl-L-isoleucine)-cyclosporin A,Prednylidene,Fluocortin,Begelomab,Fluperolone,Cloprednol,Fluclorolone,Fluticasone,Tetrandrine,Monomethyl fumarate,Mometasone furoate,Hydrocortisone acetate,Hydrocortisone succinate,Emapalumab,Risankizumab,Rozanolixizumab,Bleselumab,Clobetasol propionate,Fluocinonide,Hydrocortisone butyrate,Desoximetasone,Mometasone,Fluocortolone,Fluorometholone,Difluocortolone,Upadacitinib,Ponesimod,Lexacalcitol,Inolimomab,Fasitibant,Natalizumab,Pimecrolimus,Roflumilast,Sipuleucel-T,Aldesleukin,Clozapine,Methadone,Ribavirin,Zolmitriptan,Sulfamethoxazole,Telbivudine,Leflunomide,Tofacitinib,Trastuzumab,Fingolimod,Tacrolimus,Caffeine,Dyphylline,Pentoxifylline,Oxtriphylline,Theobromine,Fenethylline,8-azaguanine,7,9-Dimethylguanine,Xanthine,7-Deazaguanine,Guanine,9-Methylguanine,Peldesine,Hypoxanthine,9-Deazaguanine,Propentofylline,Valomaciclovir,3-isobutyl-1-methyl-7H-xanthine,Uric acid,Doxofylline,6-O-benzylguanine,Lisofylline,Lobucavir,Cafedrine,Theodrenaline,Bamifylline,Proxyphylline,Acefylline,Etamiphylline,Pentifylline,Bufylline,Bromotheophylline,Furafylline,8-chlorotheophylline,PCS-499,G17DT,PEV3A,INGN 225,Rindopepimut,SRP 299,GI-5005,Vitespen,TG4010,Anthrax immune globulin human,Rabies virus inactivated antigen, B,Haemophilus influenzae type B strain 1482 capsular polysaccharide tetanus toxoid conjugate antigen,Rotavirus vaccine,Rabies virus inactivated antigen, A,Haemophilus influenzae type B capsular polysaccharide meningococcal outer membrane protein conjugate antigen,Clostridium tetani toxoid antigen (formaldehyde inactivated),Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated),Influenza A virus A/California/7/2009 X-181 (H1N1) antigen (propiolactone inactivated),Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated),Influenza B virus B/Brisbane/60/2008 antigen (formaldehyde inactivated),Typhoid Vi polysaccharide vaccine,Hepatitis A Vaccine,Haemophilus influenzae type B strain 20752 capsular polysaccharide tetanus toxoid conjugate antigen,Influenza A virus A/Brisbane/59/2007(H1N1) hemagglutinin antigen (propiolactone inactivated),Influenza B virus B/Brisbane/60/2008 hemagglutinin antigen (propiolactone inactivated),Influenza A virus A/California/7/2009 X-181 (H1N1) hemagglutinin antigen (propiolactone inactivated),Influenza B virus B/Brisbane/60/2008 antigen (propiolactone inactivated),Rabies immune globulin, human,Hepatitis B Vaccine (Recombinant),Tecemotide,Typhoid vaccine,Influenza A virus A/Victoria/210/2009 X-187 (H3N2) hemagglutinin antigen (formaldehyde inactivated),Influenza B virus B/Brisbane/60/2008 hemagglutinin antigen (formaldehyde inactivated),Influenza A virus A/California/7/2009 (H1N1) live (attenuated) antigen,Influenza A virus A/Victoria/210/2009 X-187 (H3N2) antigen (formaldehyde inactivated),Influenza A virus A/Perth/16/2009 (H3N2) live (attenuated) antigen,Influenza A virus A/Uruguay/716/2007(H3N2) antigen (propiolactone inactivated),Influenza A virus A/Brisbane/59/2007(H1N1) antigen (propiolactone inactivated),Smallpox (Vaccinia) Vaccine, Live,Pertussis vaccine,Yersinia pestis 195/p antigen (formaldehyde inactivated),Varicella zoster vaccine (recombinant),Modified vaccinia ankara,Ebola Zaire vaccine (live, attenuated),Moderna COVID-19 Vaccine,Measles virus vaccine live attenuated,Abciximab,Eptifibatide,Ticlopidine,Tirofiban,Acetylsalicylic acid,Dipyridamole,Iloprost,Sulfinpyrazone,Ridogrel,Sevoflurane,Epoprostenol,Nimesulide,Tesmilifene,Defibrotide,Beraprost,Ibudilast,Andrographolide,Caplacizumab,Prasugrel,Cangrelor,Tranilast,Triflusal,Ticagrelor,Icosapent ethyl,Vorapaxar,Trapidil,Naftopidil,Sarpogrelate,Ifetroban,Nitroaspirin,Ketanserin,Indobufen,Butylphthalide,Hydroxytyrosol,Ramatroban,Picotamide,Cloricromen,Linsidomine,Buflomedil,Relcovaptan,Maritime pine extract,Resveratrol,Lipegfilgrastim,Rubella virus vaccine,Varicella zoster vaccine (live/attenuated),Bacillus calmette-guerin substrain tice live antigen,Bacillus calmette-guerin substrain connaught live antigen,Yellow fever vaccine,Anthrax vaccine,Typhoid Vaccine Live,Bacillus calmette-guerin substrain danish 1331 live antigen,BCG vaccine,Human adenovirus e serotype 4 strain cl-68578 antigen,Vibrio cholerae CVD 103-HgR strain live antigen,Adenovirus type 7 vaccine live,Palifermin,Fluvoxamine,Betaxolol,Disopyramide,Lidocaine,Conjugated estrogens,Ropivacaine,Acetaminophen,Olanzapine,Chlorzoxazone,Grepafloxacin,Mirtazapine,Mexiletine,Tacrine,Triamterene,Promazine,Zolpidem,Entecavir,Nabumetone,Quinine,Fluoxetine,Chlorpromazine,Flutamide,Haloperidol,Albendazole,Rofecoxib,Cinnarizine,Propranolol,Diclofenac,Guanabenz,Verapamil,Paroxetine,Thiabendazole,Riluzole,Zileuton,Clopidogrel,Estradiol,Acyclovir,Naproxen,Trifluoperazine,Perphenazine,Terbinafine,Ranitidine,Ethanol,Maprotiline,Alosetron,Lomefloxacin,Ramelteon,Frovatriptan,Levobupivacaine,Cinacalcet,Selegiline,Tocainide,Praziquantel,Melatonin,Primaquine,Hesperetin,Nifedipine,Carvedilol,Cilostazol,Propafenone,Domperidone,Dexfenfluramine,Rasagiline,Temafloxacin,Aminophenazone,Antipyrine,Bromazepam,Thiothixene,Etoricoxib,Genistein,Phenacetin,Estrone sulfate,Flunarizine,Lorcaserin,Lofexidine,Mianserin,Eltrombopag,Asenapine,Vadimezan,Dapagliflozin,Agomelatine,Benzyl alcohol,Capsaicin,(R)-warfarin,Perampanel,Tasimelteon,Stiripentol,Zotepine,Propacetamol,Ramosetron,Binimetinib,Voxilaprevir,Triclabendazole,Rucaparib,Dihydralazine,Estradiol acetate,Estradiol benzoate,Estradiol cypionate,Estradiol dienanthate,Estradiol valerate,Istradefylline,Azelastine,Efavirenz,Metoclopramide,Bicifadine,GTS-21,Flecainide,Ethinylestradiol,Amitriptyline,Doxepin,Mephenytoin,Cyclobenzaprine,Selumetinib,Penciclovir,Fenfluramine,Mefenamic acid,Ondansetron,Methylene blue,Benzocaine,Theophylline,Warfarin,Tizanidine,Pimozide,Aminophylline,Acenocoumarol,Anagrelide,Erlotinib,Axitinib,Tegafur,Enasidenib,Tamoxifen,Imipramine,Clonidine,Clomipramine,Lepirudin,Bivalirudin,Alteplase,Urokinase,Reteplase,Anistreplase,Tenecteplase,Drotrecogin alfa,Streptokinase,Dicoumarol,Argatroban,Ardeparin,Phenindione,Fondaparinux,Pentosan polysulfate,Phenprocoumon,Heparin,Enoxaparin,4-hydroxycoumarin,Coumarin,Ximelagatran,Desmoteplase,Ancrod,Fibrinolysin,Rivaroxaban,Sulodexide,Semuloparin,Idraparinux,Astaxanthin,Apixaban,Otamixaban,Amediplase,Dabigatran etexilate,Danaparoid,Dalteparin,Tinzaparin,Ferulic acid,Ethyl biscoumacetate,Nadroparin,Ditazole,Edoxaban,Potassium citrate,Sodium citrate,Dextran,Bemiparin,Parnaparin,Desirudin,Zinc citrate,Antithrombin Alfa,Protein C,Antithrombin III human,Letaxaban,Darexaban,Betrixaban,Nafamostat,Monteplase,Gabexate,Fluindione,Protein S human,Brinase,Clorindione,Diphenadione,Tioclomarol,Melagatran,Saruplase,(S)-Warfarin,Tocopherylquinone,Edetate calcium disodium anhydrous,Dabigatran,Troxerutin,Edetic acid,Reviparin,Dermatan sulfate,SR-123781A,Dociparstat sodium,Methyclothiazide,Bendroflumethiazide,Benzthiazide,Cyclothiazide,Hydroflumethiazide,Chlorothiazide,Hydrochlorothiazide,Trichlormethiazide,Polythiazide,Mebutizide,Cyclopenthiazide,Buthiazide,Tedizolid phosphate,Cyclosporine,Ropinirole,Cyanocobalamin,Allopurinol,Magnesium,Lopinavir,Inebilizumab,Flupentixol,Bacillus calmette-guerin substrain russian BCG-I live antigen,Fexinidazole,Allogeneic processed thymus tissue,Tick-borne encephalitis vaccine (whole virus, inactivated),Ropeginterferon alfa-2b,Nuvaxovid
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon A Soln Inj 6 Million
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	6000000 unit / mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11373
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Alfa Interferons
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon A Sterile Pws 18m Unit/vial
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	18000000 unit / vial
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11374
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Antineoplastic and Immunomodulating Agents
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon A Sterile Pws 3m Unit/vial
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	3000000 unit / vial
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11375
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Cancer immunotherapy
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon A Sterile Pws 9m Unit/vial
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	9000000 unit / vial
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11376
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Cytochrome P-450 CYP1A2 Inhibitors
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A
Company	Genentech, Inc.
Brand Description	Genentech, Inc.
Prescribed For	Subcutaneous
Chemical Name	11.1 ug/0.5mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	Alpheon is a solution for injection that contains the active substance interferon alfa-2a.
Recommended Dosage	Roferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis).
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11377
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Cytochrome P-450 CYP1A2 Inhibitors (strength unknown)
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A
Company	Genentech, Inc.
Brand Description	Genentech, Inc.
Prescribed For	Subcutaneous
Chemical Name	22.2 ug/0.5mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	Alpheon is a solution for injection that contains the active substance interferon alfa-2a.
Recommended Dosage	Roferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis).
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11378
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Cytochrome P-450 Enzyme Inhibitors
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A
Company	Genentech, Inc.
Brand Description	Genentech, Inc.
Prescribed For	Subcutaneous
Chemical Name	33.3 ug/0.5mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	Alpheon is a solution for injection that contains the active substance interferon alfa-2a.
Recommended Dosage	Roferon-A (interferon alfa-2a, recombinant) is indicated for the treatment of chronic hepatitis C and hairy cell leukemia in patients 18 years of age or older. In addition, it is indicated for chronic phase, Philadelphia chromosome (Ph) positive chronic myelogenous leukemia (CML) patients who are minimally pretreated (within 1 year of diagnosis).
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11379
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Immunosuppressive Agents
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Sol Inj 3million Iu/vial
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	3000000 unit / mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11380
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Immunotherapy
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Soln-liq Im Sc 4.5million I.u/ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	4500000 IU/mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11381
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Interferon alpha
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Soln-liq Im Sc 9million I.U./ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	9000000 IU/ml
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11382
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Interferons
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Solution 18 Million I.U./3ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	18000000 IU/3mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11383
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	Myelosuppressive Agents
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Solution 3 Million I.U./ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	3 m / mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11384
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	NA
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Solution 6 Million I.U./ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	6000000 IU/mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11385
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	NA
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Solution Inj 36000000unit/ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	36000000 unit / mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA

Primary information
ID	11386
Therapeutic ID	Th1245
Protein Name	Interferon alfa-2a
Sequence	>Th1245_Interferon_alfa-2a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular Weight	19241.1
Chemical Formula	C860H1353N227O255S9
Isoelectric Point	5.99
Hydrophobicity	-0.336
Melting point	NA
Half-life	The IM half-life of interferon alfa-2a is 6 hours to 8 hours; the half-life for IV infusion is 3.7 hours to 8.5 hours (mean 5.1 hours).
Description	Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent. An oral form is being developed by Amarillo Biosciences.
Indication/Disease	For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
Pharmacodynamics	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of Action	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Toxicity	Interferon alfa-2 may cause serious adverse effects such as anemia; autoimmune diseases, including vasculitis, arthritis, hemolytic anemia, and erythematosus syndrome; cardiotoxicity; hepatotoxicity; hyperthyroidism or hypothyroidism; transient ischemic attacks; leukopenia; neurotoxicity; peripheral neuropathy; and thrombocytopenia. Some lesser side effects that may not need medical attention include blurred vision, change in taste or metallic taste, cold sores or stomatitis, diarrhea, dizziness, dry mouth, dry skin or itching, flu-like syndrome, increased sweating, leg cramps, loss of appetite, nausea or vomiting, skin rash, unusual tiredness, weight loss, and partial loss of hair.
Metabolism	NA
Absorption	Absorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
	* 0.223 to 0.748 L/kg [healthy people]
Clearance	* 2.14 - 3.62 mL/min/kg [healthy]
Categories	NA
Patents Number	NA
Date of Issue	NA
Date of Expiry	NA
Drug Interaction	NA
Target	Interferon alpha/beta receptor 1,Interferon alpha/beta receptor 2
Brand Name	Roferon-A Solution Inj. 9million I.U./0.9ml
Company	Hoffmann La Roche
Brand Description	Hoffmann La Roche
Prescribed For	Intramuscular; Subcutaneous
Chemical Name	9000000 unit / .9 mL
Formulation	Roferon-A (interferon alfa-2a, recombinant) is contraindicated in patients with: Hypersensitivity to Roferon-A (interferon alfa-2a, recombinant) or any of its components Autoimmune hepatitis Hepatic decompensation (Child-Pugh class B and C) before or during treatment Roferon-A (interferon alfa-2a, recombinant) is contraindicated in neonates and infants because it contains benzyl alcohol. Benzyl alcohol is associated with an increased incidence of neurologic and other complications in neonates and infants, which are sometimes fatal.
Physical Appearance	lu like symptoms such as fatigue (58% to 95%), fever (25% to 92%), myalgia (68% to 71%), headache (44% to 66%), chills (23% to 64%), arthralgia/bone pain (25% to 47%), asthenia (6%), sweating (5%), leg cramps (3%), and malaise (1%). Weight loss (25% to 33%), change in taste or smell (3% to 25%), pain (24%), back pain (16%), night sweats (8%), menstrual irregularity (4%), reversible hearing loss, and tinnitus have also been reported
Route of Administration	NA
Recommended Dosage	NA
Contraindication	NA
Side Effects	NA
Useful Link 1	Link
Useful Link 2	Link
Remarks	NA