|
| Primary information |
|---|
| ID | 10694 |
| Therapeutic ID | Th1157 |
| Protein Name | Sermorelin |
| Sequence | >Th1157_Sermorelin
YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
|
| Molecular Weight | 3357.882 |
| Chemical Formula | C149H246N44O42S |
| Isoelectric Point | 9.99 |
| Hydrophobicity | -0.33 |
| Melting point | NA |
| Half-life | 11-12 minutes |
| Description | Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. |
| Indication/Disease | For the treatment of dwarfism, prevention of HIV-induced weight loss |
| Pharmacodynamics | Sermorelin is used in the treatment of children with growth hormone deficiency or growth failure. Geref increases plasma growth hormone (GH) concentration by stimulating the pituitary gland to release GH. Geref is similar to the full-length native hormone (44 residues) in its ability to stimulate GH secretion in humans. |
| Mechanism of Action | Sermorelin binds to the growth hormone releasing hormone receptor and mimics native GRF in its ability to stimulate growth hormone secretion. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins,Anterior Pituitary Lobe Hormones and Analogues,Diagnostic Agents,Growth Hormone-Releasing Hormone,Hormones,Hormones, Hormone Substitutes, and Hormone Antagonists,Hypothalamic Hormones,Nerve Tissue Proteins,Neuropeptides,Peptide Hormones,Peptides,Pituitary and Hypothalamic Hormones and Analogues,Pituitary Hormone-Releasing Hormones,Somatropin and Somatropin Agonists,Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins,Tests for Pituitary Function |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Growth hormone-releasing hormone receptor |
| Brand Name | Sermorelin acetate |
| Company | Emd serono inc |
| Brand Description | Emd serono inc |
| Prescribed For | Sermorelin is approved for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage may include acute or age-related growth hormone insufficiency |
| Chemical Name | NA |
| Formulation | Two vial presentations are available, Each vial contains 0.5 mg sermorelin (as the acetate) and 5 mg mannitol. The pH is adjusted with dibasic sodium phosphate and monobasic sodium phosphate buffer. Each vial contains 3.0 mg sermorelin (as the acetate) and 5 mg mannitol. The pH is adjusted with dibasic sodium phosphate and monobasic sodium phosphate buffer. |
| Physical Appearance | Sermorelin is a sterile, non-pyrogenic, lyophilized powder |
| Route of Administration | Subcutaneous Injection |
| Recommended Dosage | A dosage of 0.2 - 0.3 mcg once daily at bedtime by subcutaneous injection is recommended. It is also recommended that subcutaneous injection sites be periodically rotated. |
| Contraindication | Sermorelin should not be used by patients with a known sensitivity to sermorelin or any of the excipients |
| Side Effects | The most common treatment-related adverse event (occurring in about 1 patient in 6) is local injection reaction characterized by pain, swelling or redness. Other treatment-related adverse events had individual occurrence rates of less than 1% and include: headache, flushing, dysphagia, dizziness, hyperactivity, somnolence and urticaria. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |