|
| Primary information |
|---|
| ID | 10690 |
| Therapeutic ID | Th1154 |
| Protein Name | OspA lipoprotein |
| Sequence | >Th1154_OspA_lipoprotein
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDVPGGMKVLVSKEKNKDGKYDLMATVDNVDLKGTSDKNNGSGILEGVKADKSKVKLTVADDLSKTTLEVLKEDGTVVSRKVTSKDKSTTEAKFNEKGELSEKTMTRANGTTLEYSQMTNEDNAAKAVETLKNGIKFEGNLASGKTAVEIKEGTVTLKREIDKNGKVTVSLNDTASGSKKTASWQESTSTLTISANSKKTKDLVFLTNGTITVQNYDSAGTKLEGSAAEIKKLDELKNALR
|
| Molecular Weight | 27743.1 |
| Chemical Formula | C1198H2012N322O422S2 |
| Isoelectric Point | 6.72 |
| Hydrophobicity | -0.652 |
| Melting point | NA |
| Half-life | 1.2 Hrs (Mammalian reticulocytes,in vitro) |
| Description | Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi sensu stricto ZS7, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant. |
| Indication/Disease | For prophylactic treatment of Lyme Disease |
| Pharmacodynamics | OspA lipoprotein is a single polypeptide chain of 270 amino acids. It is a vaccination used to prevent Lyme Disease. |
| Mechanism of Action | OspA lipoprotein, an outer surface protein of the bacteria Borrelia burgdorferi sensu stricto ZS7, is used to stimulate the production of specific antibodies against B. burgdorferi. It is used as a vaccination against Lyme Disease, a disease carried by ticks. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Vaccines |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Toll-like receptor 2 |
| Brand Name | Lymerix |
| Company | SmithKline Beecham |
| Brand Description | SmithKline Beecham |
| Prescribed For | YMErix (lipoprotein outer surface a vaccine) is indicated for active immunization against Lyme disease in individuals 15 to 70 years of age. |
| Chemical Name | NA |
| Formulation | Each 0.5 mL dose of vaccine consists of 30 mcg of lipoprotein OspA adsorbed onto 0.5 mg aluminum as aluminum hydroxide adjuvant. Each dose of the vaccine preparation contains 10 mM phosphate buffered saline and 2.5 mg of 2-phenoxyethanol, a bacteriostatic agent. |
| Physical Appearance | LYMErix (lipoprotein outer surface a vaccine) is supplied as a sterile suspension |
| Route of Administration | Intramuscular Injection |
| Recommended Dosage | Primary immunization against Lyme disease consists of a 30 mcg/0.5 mL dose of LYMErix (lipoprotein outer surface a vaccine) given at 0, 1 and 12 months. |
| Contraindication | LYMErix (lipoprotein outer surface a vaccine) is contraindicated in people with known hypersensitivity to any component of the vaccine. |
| Side Effects | Hyperntension, Diarrhea, Arthritis, Backpain, Depression, Sinusitis, Rashes, Headache, Dizziness, Depression, Fever, Fatigue. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |