Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1137 details
Primary information
ID10652
Therapeutic IDTh1137
Protein NameTeduglutide
Sequence>Th1137_Teduglutide HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular Weight3752
Chemical FormulaC164H252N44O55S
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeTerminal half-life - 2 hrs.
DescriptionRecombinant (E.coli derived) glucagon-like peptide-2 (GLP-2) analogue, made up of 33 amino acids. It differs from GLP-2 by one amino acid (A to G), which makes it more resistant to dipeptidyl peptidase-4 proteolysis, giving it a longer half-life as compared to endogenous GLP-2. FDA approved on December 21, 2012.
Indication/DiseaseTreatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support.
PharmacodynamicsAn enhancement of gastrointestinal fluid absorption (750-1000 mL/day) was observed following daily administrations of teduglutide. An increase in villus height and crypt depth of the intestinal mucosa was also noted. A decrease in fecal weight has also been observed. Teduglutide does not prolong the QTc interval.
Mechanism of ActionTeduglutide is an analog of naturally occurring human glucagon-like peptide-2 (GLP-2), a peptide secreted by L-cells of the distal intestine in response to meals. GLP-2 increases intestinal and portal blood flow and inhibit gastric acid secretion. Teduglutide binds to the glucagon-like peptide-2 receptors located in enteroendocrine cells, subepithelial myofibroblasts and enteric neurons of the submucosal and myenteric plexus. This causes the release of insulin-like growth factor (IGF)-1, nitric oxide and keratinocyte growth factor (KGF). These growth factors may contribute to the increase in crypt cell growth and surface area of the gastric mucosa. Ultimately, absorption through the intestine is enhanced.
ToxicityThe most common adverse reactions (= 10%) across all studies with GATTEX are abdominal pain, injection site reactions, nausea, headaches, abdominal distension, upper respiratory tract infection. In addition, vomiting and fluid overload were reported in the SBS studies (1 and 3) at rates = 10%.
MetabolismAlthough a formal investigation has not been conducted, it is expected because teduglutide is a peptide-based drug, it will be degraded into smaller peptides and amino acids via catabolic pathways. The cytochrome P450 enzyme system is not involved in the metabolism of this drug.
AbsorptionThe pharmacokinetic profile of teduglutide (when administered subcutaneously) is described by a one-compartment model with first order absorption in the abdomen, arm, and thigh. With escalating doses, teduglutide demonstrates linear pharmacokinetics. Absolute bioavailability, SubQ = 88%; Tmax, SubQ = 3-5 hours; Cmax, 0.05 mg/kg SubQ, SBS patients = 36 ng/mL; AUC, 0.05 mg/kg SubQ, SBS patients = 0.15 µg•hr/mL; Teduglutide does not accumulate following multiple subcutaneous administrations.
Vd, healthy subjects = 103 mL/kg
ClearancePlasma clearance, healthy subjects = 123 mL/hr/kg; This value indicates that teduglutide is primarily cleared by the kidney.
CategoriesNA
Patents NumberUS5789379
Date of Issue8-Apr-1998
Date of Expiry14-10-2020
Drug InteractionNA
TargetGlucagon-like peptide 2 receptor
Brand NameGattex
CompanyNPS Pharmaceuticals, Inc
Brand DescriptionNPS Pharmaceuticals, Inc
Prescribed ForShort Bowel Syndrome (SBS)
Chemical NameNA
FormulationEach single-use vial of GATTEX contains 5 mg of teduglutide as a white lyophilized powder for solution for subcutaneous injection. In addition to the active pharmaceutical ingredient (teduglutide), each vial of GATTEX contains 3.88 mg L-histidine, 15 mg mannitol, 0.644 mg monobasic sodium phosphate monohydrate, 3.434 mg dibasic sodium phosphate heptahydrate as excipients. No preservatives are present.
Physical Appearance Teduglutide drug substance is a clear, colorless to light-straw–colored liquid.
Route of AdministrationSubcutaneous
Recommended Dosage0.05 mg/kg body weight administered by subcutaneous injection once daily
ContraindicationNA
Side Effectsabdominal pain , injection site reactions, nausea, headaches , abdominal distension, upper respiratory tract infection.
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID10653
Therapeutic IDTh1137
Protein NameTeduglutide
Sequence>Th1137_Teduglutide HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular Weight3752
Chemical FormulaC164H252N44O55S
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeTerminal half-life - 2 hrs.
DescriptionRecombinant (E.coli derived) glucagon-like peptide-2 (GLP-2) analogue, made up of 33 amino acids. It differs from GLP-2 by one amino acid (A to G), which makes it more resistant to dipeptidyl peptidase-4 proteolysis, giving it a longer half-life as compared to endogenous GLP-2. FDA approved on December 21, 2012.
Indication/DiseaseTreatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support.
PharmacodynamicsAn enhancement of gastrointestinal fluid absorption (750-1000 mL/day) was observed following daily administrations of teduglutide. An increase in villus height and crypt depth of the intestinal mucosa was also noted. A decrease in fecal weight has also been observed. Teduglutide does not prolong the QTc interval.
Mechanism of ActionTeduglutide is an analog of naturally occurring human glucagon-like peptide-2 (GLP-2), a peptide secreted by L-cells of the distal intestine in response to meals. GLP-2 increases intestinal and portal blood flow and inhibit gastric acid secretion. Teduglutide binds to the glucagon-like peptide-2 receptors located in enteroendocrine cells, subepithelial myofibroblasts and enteric neurons of the submucosal and myenteric plexus. This causes the release of insulin-like growth factor (IGF)-1, nitric oxide and keratinocyte growth factor (KGF). These growth factors may contribute to the increase in crypt cell growth and surface area of the gastric mucosa. Ultimately, absorption through the intestine is enhanced.
ToxicityThe most common adverse reactions (= 10%) across all studies with GATTEX are abdominal pain, injection site reactions, nausea, headaches, abdominal distension, upper respiratory tract infection. In addition, vomiting and fluid overload were reported in the SBS studies (1 and 3) at rates = 10%.
MetabolismAlthough a formal investigation has not been conducted, it is expected because teduglutide is a peptide-based drug, it will be degraded into smaller peptides and amino acids via catabolic pathways. The cytochrome P450 enzyme system is not involved in the metabolism of this drug.
AbsorptionThe pharmacokinetic profile of teduglutide (when administered subcutaneously) is described by a one-compartment model with first order absorption in the abdomen, arm, and thigh. With escalating doses, teduglutide demonstrates linear pharmacokinetics. Absolute bioavailability, SubQ = 88%; Tmax, SubQ = 3-5 hours; Cmax, 0.05 mg/kg SubQ, SBS patients = 36 ng/mL; AUC, 0.05 mg/kg SubQ, SBS patients = 0.15 µg•hr/mL; Teduglutide does not accumulate following multiple subcutaneous administrations.
Vd, healthy subjects = 103 mL/kg
ClearancePlasma clearance, healthy subjects = 123 mL/hr/kg; This value indicates that teduglutide is primarily cleared by the kidney.
CategoriesNA
Patents NumberUS7056886
Date of Issue6-Jun-2006
Date of Expiry18-03-2023
Drug InteractionNA
TargetGlucagon-like peptide 2 receptor
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA


Primary information
ID10654
Therapeutic IDTh1137
Protein NameTeduglutide
Sequence>Th1137_Teduglutide HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular Weight3752
Chemical FormulaC164H252N44O55S
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeTerminal half-life - 2 hrs.
DescriptionRecombinant (E.coli derived) glucagon-like peptide-2 (GLP-2) analogue, made up of 33 amino acids. It differs from GLP-2 by one amino acid (A to G), which makes it more resistant to dipeptidyl peptidase-4 proteolysis, giving it a longer half-life as compared to endogenous GLP-2. FDA approved on December 21, 2012.
Indication/DiseaseTreatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support.
PharmacodynamicsAn enhancement of gastrointestinal fluid absorption (750-1000 mL/day) was observed following daily administrations of teduglutide. An increase in villus height and crypt depth of the intestinal mucosa was also noted. A decrease in fecal weight has also been observed. Teduglutide does not prolong the QTc interval.
Mechanism of ActionTeduglutide is an analog of naturally occurring human glucagon-like peptide-2 (GLP-2), a peptide secreted by L-cells of the distal intestine in response to meals. GLP-2 increases intestinal and portal blood flow and inhibit gastric acid secretion. Teduglutide binds to the glucagon-like peptide-2 receptors located in enteroendocrine cells, subepithelial myofibroblasts and enteric neurons of the submucosal and myenteric plexus. This causes the release of insulin-like growth factor (IGF)-1, nitric oxide and keratinocyte growth factor (KGF). These growth factors may contribute to the increase in crypt cell growth and surface area of the gastric mucosa. Ultimately, absorption through the intestine is enhanced.
ToxicityThe most common adverse reactions (= 10%) across all studies with GATTEX are abdominal pain, injection site reactions, nausea, headaches, abdominal distension, upper respiratory tract infection. In addition, vomiting and fluid overload were reported in the SBS studies (1 and 3) at rates = 10%.
MetabolismAlthough a formal investigation has not been conducted, it is expected because teduglutide is a peptide-based drug, it will be degraded into smaller peptides and amino acids via catabolic pathways. The cytochrome P450 enzyme system is not involved in the metabolism of this drug.
AbsorptionThe pharmacokinetic profile of teduglutide (when administered subcutaneously) is described by a one-compartment model with first order absorption in the abdomen, arm, and thigh. With escalating doses, teduglutide demonstrates linear pharmacokinetics. Absolute bioavailability, SubQ = 88%; Tmax, SubQ = 3-5 hours; Cmax, 0.05 mg/kg SubQ, SBS patients = 36 ng/mL; AUC, 0.05 mg/kg SubQ, SBS patients = 0.15 µg•hr/mL; Teduglutide does not accumulate following multiple subcutaneous administrations.
Vd, healthy subjects = 103 mL/kg
ClearancePlasma clearance, healthy subjects = 123 mL/hr/kg; This value indicates that teduglutide is primarily cleared by the kidney.
CategoriesNA
Patents NumberUS7847061
Date of Issue12-Jul-2010
Date of Expiry5-Jan-2026
Drug InteractionNA
TargetGlucagon-like peptide 2 receptor
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA