| Primary information |
|---|
| ID | 10561 |
| Therapeutic ID | Th1112 |
| Protein Name | Natural alpha interferon OR multiferon |
| Sequence | >Th1112_Natural_alpha_interferon_OR_multiferon
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
|
| Molecular Weight | 19300-22100 |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Obtained from the leukocyte fraction of human blood following Sendai virus infection. Interferon alfa contains several naturally occurring IFN-α subtypes and is purified by affinity chromatography. Interferon alpha proteins are mainly involved in innate immune response against viral infection. They come in 13 subtypes that are called IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17, IFNA21. Multiferon consists of the 6 major subtypes are IFN-α1, IFN-α2, IFN-α8, IFN-α10, IFN-α14 and IFN-α21. Of these, IFN-α2 and IFN-α14 are glycosylated. |
| Indication/Disease | Investigated for use/treatment in hepatitis (viral, C), leukemia (lymphoid), leukemia (myeloid), leukemia (unspecified), and melanoma. |
| Pharmacodynamics | NA |
| Mechanism of Action | Natural alpha interferon offers multiple subtypes of interferon which may work together as a 'cocktail-in-one', while recombinant versions only exhibit a single subtype. Viragen offers MultiferonT at a cost which is competitive with recombinant interferon regimens. Natural alpha interferon contains the multiple subtype composition that is characteristic of interferon produced by the human body. It is believed that this results in a broader spectrum of specific anti-viral and immunoregulatory activity with the subtypes acting synergistically to give a wide-ranging response. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Intron/ Roferon-A |
| Company | NA |
| Brand Description | NA |
| Prescribed For | Approved for use in hairy cell leukemia, malignant melanoma, AIDS-related Kaposi's sarcoma, follicular non-Hodgkin's lymphoma. Other uses: Chronic myelogenous leukemia (CML), renal cell cancer, cervical cancer, carcinoid syndrome, medullary thyroid cancer, multiple myeloma, basal and squamous cell skin cancers, low-grade non-Hodgkin's lymphoma, cutaneous T-cell lymphoma (mycosis fungoides). Blood disorders such as: polycythemia vera, essential thrombocytopenia, thrombocytopenia purpura. |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | Subcutaneous, Intravenous, Intramuscular |
| Recommended Dosage | NA |
| Contraindication | Do not take aspirin, products containing aspirin unless your doctor specifically permits this; Do not receive any kind of immunization or vaccination without your doctor's approval while taking interferon alpha; Due to differences in dosage, you should not change brands of interferons. Discuss with your doctor or health care professional if there is a problem with supply. Interferon alfa may cause patients to develop mood or behavioral problems or if you have ever been addicted to drugs or alcohol. Pregnancy category C (use in pregnancy only when benefit to the mother outweighs risk to the fetus). For both men and women: Do not conceive a child (get pregnant) while taking interferon alfa. Barrier methods of contraception, such as condoms, are recommended. Discuss with your doctor when you may safely become pregnant or conceive a child after therapy. Do not breast feed while taking this medication. |
| Side Effects | Flu-like syndrome: Fever, chills, generalized aches and pains, headache, poor appetite, Fatigue, Low blood counts, anaemia and/or bleeding. Decreases are dose dependent. Temporary blood test abnormalities: low calcium, high glucose, or high triglyceride levels. Increases in blood tests measuring liver function. These return to normal once treatment is discontinued (see liver problems). Weight loss, Hair loss. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |