| Primary information |
|---|
| ID | 10481 |
| Therapeutic ID | Th1089 |
| Protein Name | Palivizumab |
| Sequence | >Th1089_Palivizumab
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSS
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | 61 (FAB fr |
| Half-life | 18-20 days (in adults) |
| Description | Humanized, recombinant, monoclonal antibody (IgG1k) directed agaisnt the epitope in the A antigenic site of the F protein of respiratory syncytial virus (RSV). Synagis is a composite of human (95%) and murine (5%) antibody sequences. The human heavy chain sequence is derived from the constant domains of human IgG1 and the variable framework regions of the VH genes Cor (1) and Cess (2). The human light chain sequence is derived from the constant domain of Ck and the variable framework regions of the VL gene K104 withJk-4. Palivizumab is expressed from a stable murine myeloma cell line (NS0). Palivizumab is composed of to heavy chains (50.6 kDa each) and two light chains (27.6 kDa each), contains 1-2% carbohydrate by weight and has a molecular weight of 147.7 kDa ± 1 kDa (MALDI-TOF). |
| Indication/Disease | For prophylaxis of respiratory diseases casued by respiratory syncytial virus. |
| Pharmacodynamics | Synagis exhibits neutralizing and fusion-inhibitory activity against Respiratory syncytial virus (RSV). These activities inhibit RSV replication or spread. Synagis is given to prevent the development of lower respiratory tract disease in pediatric patients. |
| Mechanism of Action | Palivizumab binds to the fusion glycoprotein of RSV. This prevents its binding and uptake by host cellular receptors. |
| Toxicity | NA |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins,Anti-Infective Agents,Antibodies,Antibodies, Monoclonal,Antibodies, Monoclonal, Humanized,Antiinfectives for Systemic Use,Antiviral Agents,Blood Proteins,Fusion Protein Inhibitors,Globulins,Immune Sera and Immunoglobulins,Immunoglobulins,Immunoproteins,Proteins,Respiratory Syncytial Virus Anti-F Protein Monoclonal Antibody,Serum Globulins,Specific Immunoglobulins |
| Patents Number | CA2197684 |
| Date of Issue | 31-Oct-2000 |
| Date of Expiry | 9-Aug-2015 |
| Drug Interaction | NA |
| Target | Fusion glycoprotein F0,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamma Fc region receptor III-A,High affinity immunoglobulin gamma Fc receptor I,Low affinity immunoglobulin gamma Fc region receptor II-b |
| Brand Name | Synagis |
| Company | MedImmune |
| Brand Description | MedImmune |
| Prescribed For | Palivizumab inhibits the actions of respiratory syncytial virus (RSV) and helps to prevent the disease |
| Chemical Name | NA |
| Formulation | 100 mg single-dose vial of Synagis liquid solution contains 100 mg of palivizumab and also contains chloride (0.5 mg), glycine (0.1 mg), and histidine (3.9 mg), in a volume of 1 mL. |
| Physical Appearance | Sterile, preservative-free liquid solution |
| Route of Administration | Intramuscular |
| Recommended Dosage | recommended dose of Synagis is 15 mg per kg of body weight given monthly by intramuscular injection. The first dose of Synagis should be administered prior to commencement of the RSV season and the remaining doses should be administered monthly throughout the RSV season. Children who develop an RSV infection should continue to receive monthly doses throughout the RSV season. In the northern hemisphere, the RSV season typically commences in November and lasts through April, but it may begin earlier or persist later in certain communities. |
| Contraindication | indicated for the prevention of serious lower respiratory tract disease caused by respiratory syncytial virus (RSV) in children at high risk of RSV disease.The following points should be considered when prescribing Synagis: Safety and efficacy were established in children with bronchopulmonary dysplasia (BPD), infants with a history of premature birth (less than or equal to 35 weeks gestational age), and children with hemodynamically significant congenital heart disease (CHD). |
| Side Effects | high fever, ear pain or drainage, tugging at the ear; warmth or swelling of the ear; crying or fussiness, especially while lying down; change in sleeping patterns; poor feeding or loss of appetite; easy bruising or bleeding; or trouble breathing. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |