Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1068 details
Primary information
ID10412
Therapeutic IDTh1068
Protein NameTositumomab
Sequence>Th1068_Tositumomab QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight143859.7
Chemical FormulaC6416H9874N1688O1987S44
Isoelectric Point8.68
Hydrophobicity-0.4144
Melting point71
Half-life0.8 hours (mammalian reticulocytes, in vitro)
DescriptionMurine IgG2a lambda monoclonal antibody against CD20 antigen (2 heavy chains of 451 residues, 2 lambda chains of 220 residues). It is produced in an antibiotic-free culture of mammalian cells. It can be covalently linked to Iodine 131 (a radioactive isotope of iodine).
Indication/DiseaseFor treatment of non-Hodgkin's lymphoma (CD20 positive, follicular)
PharmacodynamicsTositumomab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of ActionBinds to the CD20 antigen which is found on mature B lymphocytes. The antibody binding appears to induce apoptosis, complement-dependent cytotoxicity and cell death through ionizing radiation.
ToxicityNA
MetabolismMost likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production
AbsorptionNA
NA
Clearance68.2 mg/hr [patients with NHL]
CategoriesAmino Acids, Peptides, and Proteins, Antibodies, Antigens, CD20, Antineoplastic Agents, Blood Proteins, CD20-directed Antibody Interactions, CD20-directed Radiotherapeutic Antibody, Drugs that are Mainly Renally Excreted, Globulins, Immunoglobulins, Immunoproteins, Immunosuppressive Agents, Iodine (131I) Compounds, Myelosuppressive Agents, Proteins, Radioimmunotherapy, Radiopharmaceutical Activity, Serum Globulins, Therapeutic Radiopharmaceutical
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNatalizumab with immunosuppressant, Tositumomab, may increase the adverse effects. Increased risk of Progressive Multifocal Leukoencephalopathy (PML) and other infections. Concurrent therapy should be avoided
TargetB-lymphocyte antigen CD20,Low affinity immunoglobulin gamma Fc region receptor II-b
Brand NameBexxar
CompanyGalaxo Smith Kline
Brand DescriptionGalaxo Smith Kline
Prescribed ForThe BEXXAR therapeutic regimen (Tositumomab and Iodine I 131 Tositumomab) is indicated for the treatment of patients with CD20 antigen-expressing relapsed or refractory, low grade, follicular, or transformed non-Hodgkin's lymphoma, including patients with Rituximab-refractory non-Hodgkin’s lymphoma. Determination of the effectiveness of the BEXXAR therapeutic regimen is based on overall response rates in patients whose disease is refractory to chemotherapy alone or to chemotherapy and Rituximab. The effects of the BEXXAR therapeutic regimen on survival are not known.
Chemical NameNA
FormulationThe formulation contains 100 mg/mL maltose, 8.5 mg/mL sodium chloride, 1 mg/mL phosphate, 1 mg/mL potassium hydroxide, and Water for Injection, USP. The pH is approximately 7.2.
Physical Appearance Tositumomab is supplied as a Sterile, pyrogen-free, clear to opalescent, colorless to slightly yellow, preservative-free solutionÂÂ
Route of AdministrationIntravenous (Intravenous) administration
Recommended DosageThe BEXXAR therapeutic regimen consists of 2 separate components (tositumomab and iodine I 131 tositumomab) administered in 2 separate steps (dosimetric dose and therapeutic dose) separated by 7 to 14 days.Tositumomab 450 mg by Intravenous infusion.I-131 tositumomab (5 mCi I-131 and 35 mg protein) by Intravenous infusion
ContraindicationThe BEXXAR therapeutic regimen is contraindicated in patients with known hypersensitivity to murine proteins or any other component of the BEXXAR therapeutic regimen.
Side EffectsSerious Allergic Reactions, Including Anaphylaxis, Prolonged and Severe Cytopenias, Secondary malignancies, Hypothyroidism, neutropenia, thrombocytopenia, anemia, infections (including pneumonia, bacteremia, septicemia, bronchitis, and skin infections), infusion reactions, asthenia, fever, and nausea.
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID10413
Therapeutic IDTh1068
Protein NameTositumomab
Sequence>Th1068_Tositumomab QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight143859.7
Chemical FormulaC6416H9874N1688O1987S44
Isoelectric Point8.68
Hydrophobicity-0.4144
Melting point71
Half-life0.8 hours (mammalian reticulocytes, in vitro)
DescriptionMurine IgG2a lambda monoclonal antibody against CD20 antigen (2 heavy chains of 451 residues, 2 lambda chains of 220 residues). It is produced in an antibiotic-free culture of mammalian cells. It can be covalently linked to Iodine 131 (a radioactive isotope of iodine).
Indication/DiseaseFor treatment of non-Hodgkin's lymphoma (CD20 positive, follicular)
PharmacodynamicsTositumomab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of ActionBinds to the CD20 antigen which is found on mature B lymphocytes. The antibody binding appears to induce apoptosis, complement-dependent cytotoxicity and cell death through ionizing radiation.
ToxicityNA
MetabolismMost likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production
AbsorptionNA
NA
Clearance68.2 mg/hr [patients with NHL]
CategoriesAmino Acids, Peptides, and Proteins, Antibodies, Antigens, CD20, Antineoplastic Agents, Blood Proteins, CD20-directed Antibody Interactions, CD20-directed Radiotherapeutic Antibody, Drugs that are Mainly Renally Excreted, Globulins, Immunoglobulins, Immunoproteins, Immunosuppressive Agents, Iodine (131I) Compounds, Myelosuppressive Agents, Proteins, Radioimmunotherapy, Radiopharmaceutical Activity, Serum Globulins, Therapeutic Radiopharmaceutical
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionTrastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA


Primary information
ID10414
Therapeutic IDTh1068
Protein NameTositumomab
Sequence>Th1068_Tositumomab QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight143859.7
Chemical FormulaC6416H9874N1688O1987S44
Isoelectric Point8.68
Hydrophobicity-0.4144
Melting point71
Half-life0.8 hours (mammalian reticulocytes, in vitro)
DescriptionMurine IgG2a lambda monoclonal antibody against CD20 antigen (2 heavy chains of 451 residues, 2 lambda chains of 220 residues). It is produced in an antibiotic-free culture of mammalian cells. It can be covalently linked to Iodine 131 (a radioactive isotope of iodine).
Indication/DiseaseFor treatment of non-Hodgkin's lymphoma (CD20 positive, follicular)
PharmacodynamicsTositumomab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of ActionBinds to the CD20 antigen which is found on mature B lymphocytes. The antibody binding appears to induce apoptosis, complement-dependent cytotoxicity and cell death through ionizing radiation.
ToxicityNA
MetabolismMost likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production
AbsorptionNA
NA
Clearance68.2 mg/hr [patients with NHL]
CategoriesAmino Acids, Peptides, and Proteins, Antibodies, Antigens, CD20, Antineoplastic Agents, Blood Proteins, CD20-directed Antibody Interactions, CD20-directed Radiotherapeutic Antibody, Drugs that are Mainly Renally Excreted, Globulins, Immunoglobulins, Immunoproteins, Immunosuppressive Agents, Iodine (131I) Compounds, Myelosuppressive Agents, Proteins, Radioimmunotherapy, Radiopharmaceutical Activity, Serum Globulins, Therapeutic Radiopharmaceutical
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetBacterial outer membrane,Lipoteichoic acid synthesis
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA