Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1065 details |
| Primary information | |
|---|---|
| ID | 10403 |
| Therapeutic ID | Th1065 |
| Protein Name | Digoxin Immune Fab (Ovine) |
| Sequence | >Th1065_Digoxin_Immune_Fab_(Ovine) EVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP |
| Molecular Weight | 47301.7 |
| Chemical Formula | C2085H3223N553O672S16 |
| Isoelectric Point | 8.01 |
| Hydrophobicity | -0.343 |
| Melting point | 61 (FAB f |
| Half-life | 15-20 hrs |
| Description | Digoxin Immune Fab is a sheep antibody (26-10) FAB fragment from sheep immunized with the digoxin derivative Digoxindicarboxymethylamine. It is used as an antidote for overdose of digoxin. |
| Indication/Disease | For treatment of digitoxin overdose or digitalis glycoside toxicity. |
| Pharmacodynamics | DigiFab binds molecules of digoxin, making them unavailable for binding at their site of action on cells in the body. The Fab fragment-digoxin complex accumulates in the blood, from which it is excreted by the kidney. The net effect is to shift the equilibrium away from binding of digoxin to its receptors in the body, thereby reversing its effects. |
| Mechanism of Action | Binds excess digoxin or digitoxin molecules circulating in the blood. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| 0.3 L/kg [DigiFab] 0.4 L/kg [Digibind] | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antidotes, Blood Proteins, Digoxin Binding Activity, Immunoglobulin G, Immunoglobulins, Proteins, Serum, Serum Globulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Cinitapride can alter the absorption of digoxin as it simulates gastric emptying |
| Target | Digoxin |
| Brand Name | DIGIBIND |
| Company | Galaxo Smith Kline |
| Brand Description | Galaxo Smith Kline |
| Prescribed For | DIGIBIND, Digoxin Immune Fab (Ovine), is indicated for treatment of potentially life-threatening digoxin intoxication. Although designed specifically to treat life-threatening digoxin overdose, it has also been used successfully to treat life-threatening digitoxin overdose. Since human experience is limited and the consequences of repeated exposures are unknown, DIGIBIND is not indicated for milder cases of digitalis toxicity. |
| Chemical Name | NA |
| Formulation | Each vial, which will bind approximately 0.5 mg of digoxin (or digitoxin), contains 38 mg of digoxin-specific Fab fragments derived from sheep plus 75 mg of sorbitol as a stabilizer and 28 mg of sodium chloride. The vial contains no preservatives. |
| Physical Appearance | DIGIBIND, Digoxin Immune Fab (Ovine), is a Sterile lyophilized powder of antigen binding fragments (Fab) derived from specific antidigoxin antibodies raised in sheep. |
| Route of Administration | Intravenous infusion after reconstitution with Ste |
| Recommended Dosage | Each vial of DIGIBIND (digoxin immune fab) contains 38 mg of purified digoxin-specific Fab fragments which will bind approximately 0.5 mg of digoxin (or digitoxin). Dose (in # of vials) = Total digitalis body load in mg / 0.5 mg of digitalis bound/vial |
| Contraindication | There are no known contraindications to the use of DIGIBIND. |
| Side Effects | Allergic reactions to DIGIBIND (digoxin immune fab) have been reported rarely. Patients with a history of allergy, especially to antibiotics, appear to be at particular risk. In a few instances, low cardiac output states and congestive heart failure could have been exacerbated by withdrawal of the inotropic effects of digitalis. Hypokalemia may occur from re-activation of (sodium, potassium) ATPase. Patients with atrial fibrillation may develop a rapid ventricular response from withdrawal of the effects of digitalis on the atrioventricular node. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10404 |
| Therapeutic ID | Th1065 |
| Protein Name | Digoxin Immune Fab (Ovine) |
| Sequence | >Th1065_Digoxin_Immune_Fab_(Ovine) EVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP |
| Molecular Weight | 47301.7 |
| Chemical Formula | C2085H3223N553O672S16 |
| Isoelectric Point | 8.01 |
| Hydrophobicity | -0.343 |
| Melting point | 61 (FAB f |
| Half-life | 15-20 hrs |
| Description | Digoxin Immune Fab is a sheep antibody (26-10) FAB fragment from sheep immunized with the digoxin derivative Digoxindicarboxymethylamine. It is used as an antidote for overdose of digoxin. |
| Indication/Disease | For treatment of digitoxin overdose or digitalis glycoside toxicity. |
| Pharmacodynamics | DigiFab binds molecules of digoxin, making them unavailable for binding at their site of action on cells in the body. The Fab fragment-digoxin complex accumulates in the blood, from which it is excreted by the kidney. The net effect is to shift the equilibrium away from binding of digoxin to its receptors in the body, thereby reversing its effects. |
| Mechanism of Action | Binds excess digoxin or digitoxin molecules circulating in the blood. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| 0.3 L/kg [DigiFab] 0.4 L/kg [Digibind] | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antidotes, Blood Proteins, Digoxin Binding Activity, Immunoglobulin G, Immunoglobulins, Proteins, Serum, Serum Globulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | DigiFab |
| Company |  Protherics Inc, Btg International Inc, Savage Laboratories a division of Fougera Pharmaceuticals Inc. |
| Brand Description |  Protherics Inc, Btg International Inc, Savage Laboratories a division of Fougera Pharmaceuticals Inc. |
| Prescribed For | DigiFab is indicated for the treatment of patients with life-threatening or potentially life-threatening digoxin toxicity or overdose. Although designed specifically to treat digoxin overdose, a product very similar to DigiFab (Digibind) has been used successfully to treat life-threatening digitoxin overdose. |
| Chemical Name | NA |
| Formulation | Each vial of DigiFab, which will bind approximately 0.5 mg digoxin, contains 40 mg of digoxin immune Fab, 75 mg (approx) of mannitol USP, and 2 mg (approx) sodium acetate USP as a buffering agent. The product contains no preservatives after reconstitution with 4 mL of Sterile Water for Injection USP |
| Physical Appearance | DigiFab [Digoxin Immune Fab (Ovine)] is a sterile, purified, lyophilized powdered preparation of digoxin-immune ovine Fab (monovalent) immunoglobulin fragments. |
| Route of Administration | Intravenous administration |
| Recommended Dosage | For adult patients who are in acute distress or for whom a serum digoxin concentration is not available, 6 vials (240 mg) should be adequate to reverse most cases of toxicity. |
| Contraindication | There are no known contraindications to the use of DigiFab |
| Side Effects | Exacerbation of low cardiac output states and congestive heart failure due to the withdrawal of inotropic effect of digitalis. Hypokalemia due to reactivation of the sodium-potassium ATPase. Rapid ventricular response in patients with atrial fibrillation due to withdrawal of the effects of digitalis on the atrioventricular node. Rare allergic reactions Patients with a history of allergy, especially to antibiotics, appear to be at particular risk. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10405 |
| Therapeutic ID | Th1065 |
| Protein Name | Digoxin Immune Fab (Ovine) |
| Sequence | >Th1065_Digoxin_Immune_Fab_(Ovine) EVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP |
| Molecular Weight | 47301.7 |
| Chemical Formula | C2085H3223N553O672S16 |
| Isoelectric Point | 8.01 |
| Hydrophobicity | -0.343 |
| Melting point | 61 (FAB f |
| Half-life | 15-20 hrs |
| Description | Digoxin Immune Fab is a sheep antibody (26-10) FAB fragment from sheep immunized with the digoxin derivative Digoxindicarboxymethylamine. It is used as an antidote for overdose of digoxin. |
| Indication/Disease | For treatment of digitoxin overdose or digitalis glycoside toxicity. |
| Pharmacodynamics | DigiFab binds molecules of digoxin, making them unavailable for binding at their site of action on cells in the body. The Fab fragment-digoxin complex accumulates in the blood, from which it is excreted by the kidney. The net effect is to shift the equilibrium away from binding of digoxin to its receptors in the body, thereby reversing its effects. |
| Mechanism of Action | Binds excess digoxin or digitoxin molecules circulating in the blood. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| 0.3 L/kg [DigiFab] 0.4 L/kg [Digibind] | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antidotes, Blood Proteins, Digoxin Binding Activity, Immunoglobulin G, Immunoglobulins, Proteins, Serum, Serum Globulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | T-cell surface glycoprotein CD3 delta chain, T-cell surface glycoprotein CD3 epsilon chain, T-cell surface glycoprotein CD3 gamma chain, T-cell surface glycoprotein CD3 zeta chain, Low affinity immunoglobulin gamma Fc region receptor III-B, Complement C1r subcomponent, Complement C1q subcomponent subunit A, Complement C1q subcomponent subunit B, Complement C1q subcomponent subunit C, Low affinity immunoglobulin gamma Fc region receptor III-A, Complement C1s subcomponent, High affinity immunoglobulin gamma Fc receptor I, Low affinity immunoglobulin gamma Fc region receptor II-a, Low affinity immunoglobulin gamma Fc region receptor II-b, Low affinity immunoglobulin gamma Fc region receptor II-c |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |