Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1059 details
Primary information
ID10381
Therapeutic IDTh1059
Protein NameHyaluronidase
Sequence>Th1059_Hyaluronidase MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPR
Molecular Weight53870.9
Chemical FormulaC2455H3775N617O704S21
Isoelectric Point5.73
Hydrophobicity-0.117
Melting pointNA
Half-life0.03 hours
DescriptionHighly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.
Indication/DiseaseFor increase of absorption and distribution of other injected drugs and for rehydration.
PharmacodynamicsHyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.
Mechanism of ActionHyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.
ToxicityNA
MetabolismNA
AbsorptionNA
NA
ClearanceNA
CategoriesBlood and Blood Forming Organs, Carbon-Oxygen Lyases, Enzymes, Enzymes and Coenzymes, Glycoside Hydrolases, Hyaluronoglucosaminidase, antagonists & inhibitors, Hydrolases, Lyases, Polysaccharide-Lyases
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetHyaluronic acid, Transforming growth factor beta-1
Brand NameHYLENEX
CompanyBaxter Healthcare Corporation
Brand DescriptionBaxter Healthcare Corporation
Prescribed ForHYLENEX recombinant is indicated as an adjuvant in subcutaneous fluid administration for achieving hydration, to increase the dispersion and absorption of other injected drug and an adjunct in subcutaneous urography for improving resorption of radioopque agents
Chemical NameNA
FormulationEach mL contains 150 USP units of recombinant human hyaluronidase with 8.5 mg sodium chloride, 1.4 mg dibasic sodium phosphate, 1.0 mg albumin human, 0.9 mg edentate disodium, 0.3 mg calcium chloride, and sodium hydroxide added for pH adjustment.
Physical Appearance HYLENEX recombinant (hyaluronidase human injection) is supplied as a Sterile, clear, colorless, nonpreserved, ready for use solution.
Route of Administrationhuman Injection Subcutaneous use
Recommended DosageMost typically 150 U hyaluronidaseare used to the injection (hyaluronidase human injection) for the subcutaneous fluid administration, will facilitate absorption of 1,000 mL or more of solution.
ContraindicationHYLENEX is contraindicated in patients with known hypersensitivity to hyaluronidase or any of the excipients
Side Effectsadverse experiences have been mild local injection site reactions such as erythema and pain. Edema has been reported most frequently.
Useful Link 1Link
Useful Link 2NA
RemarksNA