Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1034 details |
| Primary information | |
|---|---|
| ID | 10246 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Increases toxicity of bendamustine. Should not be administered within a 24 hour time period of antineoplastic agent administration. |
| Target | Fibroblast growth factor receptor 2,Neuropilin-1,Fibroblast growth factor receptor 1,Fibroblast growth factor receptor 4,Fibroblast growth factor receptor 3,Basement membrane-specific heparan sulfate proteoglycan core protein |
| Brand Name | Kepivance |
| Company | Amgen Inc, BioVitrum AB |
| Brand Description | Amgen Inc, BioVitrum AB |
| Prescribed For | Kepivance is used to help prevent or heal mouth sores and ulcers in people being treated with chemotherapy and stem cell treatment. It is used in people receiving chemotherapy to treat blood cancers (Hodgkin's disease, multiple myeloma, leukemia). |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | Sterile, lyophilized powder |
| Route of Administration | Intravenous infusion |
| Recommended Dosage | The recommended dose of Kepivance is 60 mcg/kg/day, administered as an intravenous bolus injection for 3 consecutive days before and 3 consecutive days after myelotoxic therapy, for a total of 6 doses. |
| Contraindication | NA |
| Side Effects | Fever; swelling or redness of your skin; itching or rash; changes in your sense of taste or sense of touch; unusual or unpleasant sensations in your mouth; numbness in or around your mouth; joint pain; or discolored or thickened tongue. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10247 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Increases the toxicity of pralatrexate. Avoid concomitant therapy or do not use palifermin within 24 hours after administration of pralatrexate. |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10248 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10249 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10250 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10251 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |